Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
| Location | 1754552..1754773 | Replicon | chromosome |
| Accession | NZ_CP103864 | ||
| Organism | Escherichia coli O157:H7 strain RV06 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | NUE47_RS08675 | Protein ID | WP_001295224.1 |
| Coordinates | 1754552..1754659 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 1754708..1754773 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE47_RS08650 (1749805) | 1749805..1750557 | - | 753 | Protein_1685 | cellulose biosynthesis protein BcsQ | - |
| NUE47_RS08655 (1750569) | 1750569..1750757 | - | 189 | WP_001063316.1 | cellulose biosynthesis protein BcsR | - |
| NUE47_RS08660 (1751030) | 1751030..1752601 | + | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| NUE47_RS08665 (1752598) | 1752598..1752789 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| NUE47_RS08670 (1752786) | 1752786..1754465 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| NUE47_RS08675 (1754552) | 1754552..1754659 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1754708) | 1754708..1754773 | + | 66 | NuclAT_17 | - | Antitoxin |
| - (1754708) | 1754708..1754773 | + | 66 | NuclAT_17 | - | Antitoxin |
| - (1754708) | 1754708..1754773 | + | 66 | NuclAT_17 | - | Antitoxin |
| - (1754708) | 1754708..1754773 | + | 66 | NuclAT_17 | - | Antitoxin |
| - (1754708) | 1754708..1754773 | + | 66 | NuclAT_22 | - | Antitoxin |
| - (1754708) | 1754708..1754773 | + | 66 | NuclAT_22 | - | Antitoxin |
| - (1754708) | 1754708..1754773 | + | 66 | NuclAT_22 | - | Antitoxin |
| - (1754708) | 1754708..1754773 | + | 66 | NuclAT_22 | - | Antitoxin |
| NUE47_RS08680 (1755135) | 1755135..1756406 | + | 1272 | WP_001301684.1 | aromatic amino acid transport family protein | - |
| NUE47_RS08685 (1756436) | 1756436..1757440 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| NUE47_RS08690 (1757437) | 1757437..1758420 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| NUE47_RS08695 (1758431) | 1758431..1759333 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T256853 WP_001295224.1 NZ_CP103864:c1754659-1754552 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 66 bp
>AT256853 NZ_CP103864:1754708-1754773 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
