Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 1043597..1043926 | Replicon | chromosome |
| Accession | NZ_CP103863 | ||
| Organism | Enterococcus faecalis strain SJ82 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A3N3Z2N6 |
| Locus tag | NYR15_RS05125 | Protein ID | WP_073340360.1 |
| Coordinates | 1043597..1043737 (+) | Length | 47 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 1043877..1043926 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR15_RS05105 | 1038811..1039803 | + | 993 | WP_002354765.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| NYR15_RS05110 | 1040067..1040696 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
| NYR15_RS05115 | 1041389..1043005 | + | 1617 | WP_104681241.1 | phosphatase PAP2/LCP family protein | - |
| NYR15_RS05120 | 1043335..1043478 | + | 144 | WP_002392818.1 | type I toxin-antitoxin system toxin PepG1 | - |
| NYR15_RS05125 | 1043597..1043737 | + | 141 | WP_073340360.1 | putative holin-like toxin | Toxin |
| - | 1043877..1043926 | + | 50 | - | - | Antitoxin |
| NYR15_RS05130 | 1043928..1046924 | - | 2997 | WP_002385134.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 47 a.a. Molecular weight: 5218.33 Da Isoelectric Point: 10.3265
>T256843 WP_073340360.1 NZ_CP103863:1043597-1043737 [Enterococcus faecalis]
ISLKNTNKNIVYCTTYETIQTILGFGMFTIALIALIVKLLKNDKKK
ISLKNTNKNIVYCTTYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 141 bp
Antitoxin
Download Length: 50 bp
>AT256843 NZ_CP103863:1043877-1043926 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|