Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1113250..1113432 Replicon chromosome
Accession NZ_CP103860
Organism Staphylococcus aureus strain R3-8

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag NYR13_RS05800 Protein ID WP_001801861.1
Coordinates 1113337..1113432 (-) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1113250..1113309 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYR13_RS05785 1112388..1112765 + 378 WP_001037045.1 DUF1433 domain-containing protein -
NYR13_RS05790 1112959..1113135 + 177 Protein_1102 transposase -
NYR13_RS05795 1113113..1113214 - 102 WP_001791893.1 hypothetical protein -
- 1113250..1113309 + 60 - - Antitoxin
NYR13_RS05800 1113337..1113432 - 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
NYR13_RS05805 1113635..1113778 + 144 WP_001549059.1 transposase -
NYR13_RS05810 1114382..1114765 + 384 WP_000070811.1 hypothetical protein -
NYR13_RS05815 1114776..1114952 + 177 WP_000375476.1 hypothetical protein -
NYR13_RS05820 1114954..1115139 + 186 WP_000809857.1 hypothetical protein -
NYR13_RS05825 1115253..1115894 + 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
NYR13_RS05830 1116112..1116663 - 552 WP_000414205.1 hypothetical protein -
NYR13_RS05835 1116761..1117105 - 345 WP_000627551.1 DUF3969 family protein -
NYR13_RS05840 1117146..1117772 - 627 Protein_1112 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - hlgA / lukD 1080162..1150874 70712


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T256824 WP_001801861.1 NZ_CP103860:c1113432-1113337 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT256824 NZ_CP103860:1113250-1113309 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References