Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 952086..952424 | Replicon | chromosome |
| Accession | NZ_CP103860 | ||
| Organism | Staphylococcus aureus strain R3-8 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | NYR13_RS04820 | Protein ID | WP_011447039.1 |
| Coordinates | 952086..952262 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 952250..952424 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR13_RS04800 | 947321..951106 | + | 3786 | WP_000582165.1 | phage tail spike protein | - |
| NYR13_RS04805 | 951096..951248 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| NYR13_RS04810 | 951295..951582 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| NYR13_RS04815 | 951640..951936 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| NYR13_RS04820 | 952086..952262 | + | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - | 952250..952424 | - | 175 | - | - | Antitoxin |
| NYR13_RS04830 | 952474..952728 | + | 255 | WP_000611512.1 | phage holin | - |
| NYR13_RS04835 | 952740..953495 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| NYR13_RS04840 | 953686..954177 | + | 492 | WP_000919350.1 | staphylokinase | - |
| NYR13_RS04845 | 954827..955162 | + | 336 | Protein_952 | SH3 domain-containing protein | - |
| NYR13_RS04850 | 955257..955706 | - | 450 | WP_251354221.1 | chemotaxis-inhibiting protein CHIPS | - |
| NYR13_RS04855 | 956391..956741 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| NYR13_RS04860 | 956794..957054 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL / hlb / sak / chp / scn | 900793..956741 | 55948 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T256820 WP_011447039.1 NZ_CP103860:952086-952262 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT256820 NZ_CP103860:c952424-952250 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|