Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 777500..777763 | Replicon | chromosome |
| Accession | NZ_CP103860 | ||
| Organism | Staphylococcus aureus strain R3-8 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | NYR13_RS03825 | Protein ID | WP_001802298.1 |
| Coordinates | 777500..777604 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 777599..777763 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR13_RS03795 | 772884..773666 | + | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
| NYR13_RS03800 | 773734..774591 | + | 858 | WP_000370924.1 | HAD family hydrolase | - |
| NYR13_RS03805 | 774823..775007 | - | 185 | Protein_749 | exotoxin | - |
| NYR13_RS03810 | 775296..775388 | - | 93 | WP_001790138.1 | hypothetical protein | - |
| NYR13_RS03815 | 775677..776813 | + | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| NYR13_RS03820 | 776856..777339 | + | 484 | Protein_752 | recombinase family protein | - |
| NYR13_RS03825 | 777500..777604 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| - | 777599..777763 | - | 165 | - | - | Antitoxin |
| NYR13_RS03835 | 778104..779195 | - | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| NYR13_RS03840 | 779461..780441 | - | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| NYR13_RS03845 | 780443..780763 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| NYR13_RS03850 | 780915..781580 | + | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T256815 WP_001802298.1 NZ_CP103860:777500-777604 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT256815 NZ_CP103860:c777763-777599 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|