Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-as-bsrE/- |
| Location | 2301836..2302048 | Replicon | chromosome |
| Accession | NZ_CP103856 | ||
| Organism | Bacillus velezensis strain SRCM116265 | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | A0A4V7TPQ9 |
| Locus tag | NX081_RS11460 | Protein ID | WP_041482523.1 |
| Coordinates | 2301836..2302015 (-) | Length | 60 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrE | ||
| Locus tag | - | ||
| Coordinates | 2301962..2302048 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NX081_RS11445 (2297805) | 2297805..2299670 | - | 1866 | WP_259429543.1 | hypothetical protein | - |
| NX081_RS11450 (2299981) | 2299981..2301213 | - | 1233 | WP_259429544.1 | hypothetical protein | - |
| NX081_RS11455 (2301294) | 2301294..2301533 | - | 240 | WP_165882034.1 | hypothetical protein | - |
| NX081_RS11460 (2301836) | 2301836..2302015 | - | 180 | WP_041482523.1 | hypothetical protein | Toxin |
| - (2301962) | 2301962..2302048 | + | 87 | NuclAT_1 | - | Antitoxin |
| - (2301962) | 2301962..2302048 | + | 87 | NuclAT_1 | - | Antitoxin |
| - (2301962) | 2301962..2302048 | + | 87 | NuclAT_1 | - | Antitoxin |
| - (2301962) | 2301962..2302048 | + | 87 | NuclAT_1 | - | Antitoxin |
| NX081_RS11465 (2303011) | 2303011..2304123 | - | 1113 | WP_259429545.1 | cell division protein FtsZ | - |
| NX081_RS11470 (2304123) | 2304123..2304407 | - | 285 | WP_046559798.1 | hypothetical protein | - |
| NX081_RS11475 (2304586) | 2304586..2304822 | + | 237 | WP_020954165.1 | helix-turn-helix domain-containing protein | - |
| NX081_RS11480 (2304942) | 2304942..2305121 | + | 180 | WP_014417885.1 | hypothetical protein | - |
| NX081_RS11485 (2305162) | 2305162..2307036 | + | 1875 | Protein_2214 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2225178..2361362 | 136184 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 7070.74 Da Isoelectric Point: 12.4499
>T256808 WP_041482523.1 NZ_CP103856:c2302015-2301836 [Bacillus velezensis]
VLEKVGITIAFLIPITVLIINCLTIAEKIQNLMKNKESKKKKRTRKRLRSKRQRKRIRR
VLEKVGITIAFLIPITVLIINCLTIAEKIQNLMKNKESKKKKRTRKRLRSKRQRKRIRR
Download Length: 180 bp
Antitoxin
Download Length: 87 bp
>AT256808 NZ_CP103856:2301962-2302048 [Bacillus velezensis]
TAAAACCGTGATAGGAATAAGGAAAGCAATTGTTATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTATAACTC
TATTATA
TAAAACCGTGATAGGAATAAGGAAAGCAATTGTTATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTATAACTC
TATTATA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|