Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2233405..2233622 | Replicon | chromosome |
Accession | NZ_CP103850 | ||
Organism | Staphylococcus aureus strain NRL 02/947 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | NYF25_RS11165 | Protein ID | WP_001802298.1 |
Coordinates | 2233518..2233622 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2233405..2233460 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYF25_RS11140 | 2229542..2230207 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
NYF25_RS11145 | 2230359..2230679 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
NYF25_RS11150 | 2230681..2231661 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
NYF25_RS11155 | 2231927..2233018 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2233405..2233460 | + | 56 | - | - | Antitoxin |
NYF25_RS11165 | 2233518..2233622 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
NYF25_RS11170 | 2233783..2234266 | - | 484 | Protein_2158 | recombinase family protein | - |
NYF25_RS11175 | 2234309..2235445 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
NYF25_RS11180 | 2235734..2235826 | + | 93 | WP_001790138.1 | hypothetical protein | - |
NYF25_RS11190 | 2236531..2237388 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
NYF25_RS11195 | 2237456..2238238 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T256795 WP_001802298.1 NZ_CP103850:c2233622-2233518 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT256795 NZ_CP103850:2233405-2233460 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|