Detailed information of TA system TA256790

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): txpA-SprF3/-
• Location: 2033227..2033526
• Replicon: chromosome
• Accession: NZ_CP103850
• Organism: Staphylococcus aureus strain NRL 02/947

Toxin (Protein)

• Gene name: txpA
• Uniprot ID: -
• Locus tag: NYF25_RS10025
• Protein ID: WP_072353918.1
• Coordinates: 2033350..2033526 (-)
• Length: 59 a.a.

Antitoxin (RNA)

Gene name	SprF3
Locus tag	-
Coordinates	2033227..2033282 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NYF25_RS09985	2028561..2028821	+	261	WP_001791826.1	hypothetical protein	-
NYF25_RS09990	2028874..2029224	-	351	WP_000702262.1	complement inhibitor SCIN-A	-
NYF25_RS09995	2029906..2030355	+	450	WP_000727651.1	chemotaxis-inhibiting protein CHIPS	-
NYF25_RS10000	2030450..2030785	-	336	Protein_1929	SH3 domain-containing protein	-
NYF25_RS10005	2031435..2031926	-	492	WP_000919350.1	staphylokinase	-
NYF25_RS10010	2032117..2032872	-	756	WP_000861038.1	CHAP domain-containing protein	-
NYF25_RS10015	2032884..2033138	-	255	WP_000611512.1	phage holin	-
NYF25_RS10020	2033190..2033297	+	108	WP_001791821.1	hypothetical protein	-
-	2033219..2033358	+	140	NuclAT_0	-	-
-	2033219..2033358	+	140	NuclAT_0	-	-
-	2033219..2033358	+	140	NuclAT_0	-	-
-	2033219..2033358	+	140	NuclAT_0	-	-
-	2033227..2033282	+	56	-	-	Antitoxin
NYF25_RS10025	2033350..2033526	-	177	WP_072353918.1	type I toxin-antitoxin system toxin PepG1	Toxin
NYF25_RS10030	2033669..2034043	-	375	WP_000340977.1	hypothetical protein	-
NYF25_RS10035	2034099..2034386	-	288	WP_001262620.1	hypothetical protein	-
NYF25_RS10040	2034432..2034584	-	153	WP_001000058.1	hypothetical protein	-
NYF25_RS10045	2034577..2038359	-	3783	WP_031806961.1	phage tail spike protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	scn / chp / sak / hlb / groEL	2028874..2084628	55754

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (30-58)

Sequences

Toxin

Protein

• Length: 59 a.a.
• Molecular weight: 6810.43 Da
• Isoelectric Point: 9.9479

>T256790 WP_072353918.1 NZ_CP103850:c2033526-2033350 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK

Nucleotide

• Length: 177 bp

Antitoxin

Nucleotide

• Length: 56 bp

>AT256790 NZ_CP103850:2033227-2033282 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG

Structures

Antitoxin