Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1873935..1874117 Replicon chromosome
Accession NZ_CP103850
Organism Staphylococcus aureus strain NRL 02/947

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag NYF25_RS09055 Protein ID WP_001801861.1
Coordinates 1873935..1874030 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1874058..1874117 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYF25_RS09015 1869595..1870221 + 627 WP_000669046.1 hypothetical protein -
NYF25_RS09020 1870262..1870606 + 345 WP_000627551.1 DUF3969 family protein -
NYF25_RS09025 1870704..1871255 + 552 WP_000414205.1 hypothetical protein -
NYF25_RS09030 1871473..1872114 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
NYF25_RS09035 1872228..1872413 - 186 WP_000809857.1 hypothetical protein -
NYF25_RS09040 1872415..1872591 - 177 WP_000375476.1 hypothetical protein -
NYF25_RS09045 1872602..1872985 - 384 WP_000070811.1 hypothetical protein -
NYF25_RS09050 1873589..1873732 - 144 WP_001549059.1 transposase -
NYF25_RS09055 1873935..1874030 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1874058..1874117 - 60 - - Antitoxin
NYF25_RS09060 1874153..1874254 + 102 WP_001791893.1 hypothetical protein -
NYF25_RS09065 1874232..1874408 - 177 Protein_1779 transposase -
NYF25_RS09070 1874602..1874979 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukD / hlgA 1847909..1905464 57555


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T256788 WP_001801861.1 NZ_CP103850:1873935-1874030 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT256788 NZ_CP103850:c1874117-1874058 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References