Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1873935..1874117 | Replicon | chromosome |
| Accession | NZ_CP103850 | ||
| Organism | Staphylococcus aureus strain NRL 02/947 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | NYF25_RS09055 | Protein ID | WP_001801861.1 |
| Coordinates | 1873935..1874030 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1874058..1874117 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYF25_RS09015 | 1869595..1870221 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| NYF25_RS09020 | 1870262..1870606 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| NYF25_RS09025 | 1870704..1871255 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| NYF25_RS09030 | 1871473..1872114 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| NYF25_RS09035 | 1872228..1872413 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| NYF25_RS09040 | 1872415..1872591 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| NYF25_RS09045 | 1872602..1872985 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| NYF25_RS09050 | 1873589..1873732 | - | 144 | WP_001549059.1 | transposase | - |
| NYF25_RS09055 | 1873935..1874030 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1874058..1874117 | - | 60 | - | - | Antitoxin |
| NYF25_RS09060 | 1874153..1874254 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| NYF25_RS09065 | 1874232..1874408 | - | 177 | Protein_1779 | transposase | - |
| NYF25_RS09070 | 1874602..1874979 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1847909..1905464 | 57555 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T256788 WP_001801861.1 NZ_CP103850:1873935-1874030 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT256788 NZ_CP103850:c1874117-1874058 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|