Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 1855008..1855662 | Replicon | chromosome |
Accession | NZ_CP103834 | ||
Organism | Actinobacillus genomosp. |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NYR63_RS08635 | Protein ID | WP_278226473.1 |
Coordinates | 1855300..1855662 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYR63_RS08630 | Protein ID | WP_275218140.1 |
Coordinates | 1855008..1855316 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR63_RS08605 (NYR63_08600) | 1850168..1850725 | - | 558 | WP_279457153.1 | septal ring lytic transglycosylase RlpA family protein | - |
NYR63_RS08610 (NYR63_08605) | 1850900..1852024 | - | 1125 | WP_279457154.1 | rod shape-determining protein RodA | - |
NYR63_RS08615 (NYR63_08610) | 1852017..1853981 | - | 1965 | WP_279457155.1 | penicillin-binding protein 2 | - |
NYR63_RS08620 (NYR63_08615) | 1854064..1854531 | - | 468 | WP_005598965.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
NYR63_RS08625 (NYR63_08620) | 1854554..1854868 | - | 315 | WP_005619625.1 | ribosome silencing factor | - |
NYR63_RS08630 (NYR63_08625) | 1855008..1855316 | - | 309 | WP_275218140.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
NYR63_RS08635 (NYR63_08630) | 1855300..1855662 | - | 363 | WP_278226473.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR63_RS08640 (NYR63_08635) | 1855841..1858435 | - | 2595 | WP_279457156.1 | DNA mismatch repair protein MutS | - |
NYR63_RS08645 (NYR63_08640) | 1858601..1859350 | - | 750 | WP_279457157.1 | amino acid ABC transporter ATP-binding protein | - |
NYR63_RS08650 (NYR63_08645) | 1859372..1860088 | - | 717 | WP_005605560.1 | amino acid ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 14067.13 Da Isoelectric Point: 10.1215
>T256784 WP_278226473.1 NZ_CP103834:c1855662-1855300 [Actinobacillus genomosp. 1]
VKLVFVELPPFERYRQKHLSDEEYRHFQNELLENPNKGDLIQGTNGLRKIRIADMQRNKGKRGGARVIYYHIVNYSKILL
VTAYGKDEQSDLSNTERNMLANKVKRIVELEIRSCNGKTF
VKLVFVELPPFERYRQKHLSDEEYRHFQNELLENPNKGDLIQGTNGLRKIRIADMQRNKGKRGGARVIYYHIVNYSKILL
VTAYGKDEQSDLSNTERNMLANKVKRIVELEIRSCNGKTF
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|