Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 1960558..1961212 | Replicon | chromosome |
Accession | NZ_CP103825 | ||
Organism | Actinobacillus equuli subsp. haemolyticus strain 3282 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NYR80_RS09025 | Protein ID | WP_279438389.1 |
Coordinates | 1960558..1960920 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYR80_RS09030 | Protein ID | WP_275218140.1 |
Coordinates | 1960904..1961212 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR80_RS09010 (NYR80_09015) | 1956129..1956845 | + | 717 | WP_005605560.1 | amino acid ABC transporter permease | - |
NYR80_RS09015 (NYR80_09020) | 1956867..1957616 | + | 750 | WP_015674150.1 | amino acid ABC transporter ATP-binding protein | - |
NYR80_RS09020 (NYR80_09025) | 1957782..1960376 | + | 2595 | WP_279438388.1 | DNA mismatch repair protein MutS | - |
NYR80_RS09025 (NYR80_09030) | 1960558..1960920 | + | 363 | WP_279438389.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR80_RS09030 (NYR80_09035) | 1960904..1961212 | + | 309 | WP_275218140.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
NYR80_RS09035 (NYR80_09040) | 1961352..1961666 | + | 315 | WP_005619625.1 | ribosome silencing factor | - |
NYR80_RS09040 (NYR80_09045) | 1961689..1962156 | + | 468 | WP_005598965.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
NYR80_RS09045 (NYR80_09050) | 1962239..1964209 | + | 1971 | WP_279438390.1 | penicillin-binding protein 2 | - |
NYR80_RS09050 (NYR80_09055) | 1964202..1965326 | + | 1125 | WP_039198374.1 | rod shape-determining protein RodA | - |
NYR80_RS09055 (NYR80_09060) | 1965501..1966067 | + | 567 | WP_039198375.1 | septal ring lytic transglycosylase RlpA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 14044.10 Da Isoelectric Point: 10.1214
>T256748 WP_279438389.1 NZ_CP103825:1960558-1960920 [Actinobacillus equuli subsp. haemolyticus]
VKLVFVELPPFERYRQKHLSDEEYRNFQNELLENPNKGDLIQGTNGLRKIRIADMQRNKGKRGGARVIYYHIVNYSKILL
VTAYGKDEQSDLSNTERNMLANKVKRIVELEIRSCNGKTF
VKLVFVELPPFERYRQKHLSDEEYRNFQNELLENPNKGDLIQGTNGLRKIRIADMQRNKGKRGGARVIYYHIVNYSKILL
VTAYGKDEQSDLSNTERNMLANKVKRIVELEIRSCNGKTF
Download Length: 363 bp
Antitoxin
Download Length: 103 a.a. Molecular weight: 11628.49 Da Isoelectric Point: 8.5450
>AT256748 WP_275218140.1 NZ_CP103825:1960904-1961212 [Actinobacillus equuli subsp. haemolyticus]
MGKLFDDLMEGLDAYEKHIQGKITLRTTVLEKPEPVELSPSEVKSIREKLNLSQAVFAHKLHTSVRTYQGWEQGKTKPNP
QATLLLRMVDKSPQLLEQMAQL
MGKLFDDLMEGLDAYEKHIQGKITLRTTVLEKPEPVELSPSEVKSIREKLNLSQAVFAHKLHTSVRTYQGWEQGKTKPNP
QATLLLRMVDKSPQLLEQMAQL
Download Length: 309 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|