Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 1985497..1986151 | Replicon | chromosome |
Accession | NZ_CP103816 | ||
Organism | Actinobacillus equuli subsp. equuli strain 4026 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NYR70_RS09075 | Protein ID | WP_278226473.1 |
Coordinates | 1985497..1985859 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYR70_RS09080 | Protein ID | WP_275218140.1 |
Coordinates | 1985843..1986151 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR70_RS09060 (NYR70_09060) | 1981068..1981784 | + | 717 | WP_005608982.1 | amino acid ABC transporter permease | - |
NYR70_RS09065 (NYR70_09065) | 1981806..1982555 | + | 750 | WP_015674150.1 | amino acid ABC transporter ATP-binding protein | - |
NYR70_RS09070 (NYR70_09070) | 1982721..1985315 | + | 2595 | WP_279477110.1 | DNA mismatch repair protein MutS | - |
NYR70_RS09075 (NYR70_09075) | 1985497..1985859 | + | 363 | WP_278226473.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR70_RS09080 (NYR70_09080) | 1985843..1986151 | + | 309 | WP_275218140.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
NYR70_RS09085 (NYR70_09085) | 1986291..1986605 | + | 315 | WP_005619625.1 | ribosome silencing factor | - |
NYR70_RS09090 (NYR70_09090) | 1986628..1987095 | + | 468 | WP_005598965.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
NYR70_RS09095 (NYR70_09095) | 1987178..1989148 | + | 1971 | WP_279477112.1 | penicillin-binding protein 2 | - |
NYR70_RS09100 (NYR70_09100) | 1989141..1990265 | + | 1125 | WP_039198374.1 | rod shape-determining protein RodA | - |
NYR70_RS09105 (NYR70_09105) | 1990440..1991006 | + | 567 | WP_039198375.1 | septal ring lytic transglycosylase RlpA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 14067.13 Da Isoelectric Point: 10.1215
>T256721 WP_278226473.1 NZ_CP103816:1985497-1985859 [Actinobacillus equuli subsp. equuli]
VKLVFVELPPFERYRQKHLSDEEYRHFQNELLENPNKGDLIQGTNGLRKIRIADMQRNKGKRGGARVIYYHIVNYSKILL
VTAYGKDEQSDLSNTERNMLANKVKRIVELEIRSCNGKTF
VKLVFVELPPFERYRQKHLSDEEYRHFQNELLENPNKGDLIQGTNGLRKIRIADMQRNKGKRGGARVIYYHIVNYSKILL
VTAYGKDEQSDLSNTERNMLANKVKRIVELEIRSCNGKTF
Download Length: 363 bp
Antitoxin
Download Length: 103 a.a. Molecular weight: 11628.49 Da Isoelectric Point: 8.5450
>AT256721 WP_275218140.1 NZ_CP103816:1985843-1986151 [Actinobacillus equuli subsp. equuli]
MGKLFDDLMEGLDAYEKHIQGKITLRTTVLEKPEPVELSPSEVKSIREKLNLSQAVFAHKLHTSVRTYQGWEQGKTKPNP
QATLLLRMVDKSPQLLEQMAQL
MGKLFDDLMEGLDAYEKHIQGKITLRTTVLEKPEPVELSPSEVKSIREKLNLSQAVFAHKLHTSVRTYQGWEQGKTKPNP
QATLLLRMVDKSPQLLEQMAQL
Download Length: 309 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|