Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 1819926..1820580 | Replicon | chromosome |
Accession | NZ_CP103809 | ||
Organism | Actinobacillus genomosp. |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NYR62_RS08335 | Protein ID | WP_279475317.1 |
Coordinates | 1820218..1820580 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYR62_RS08330 | Protein ID | WP_275218140.1 |
Coordinates | 1819926..1820234 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR62_RS08305 (NYR62_08305) | 1815085..1815642 | - | 558 | WP_279457153.1 | septal ring lytic transglycosylase RlpA family protein | - |
NYR62_RS08310 (NYR62_08310) | 1815817..1816941 | - | 1125 | WP_279457154.1 | rod shape-determining protein RodA | - |
NYR62_RS08315 (NYR62_08315) | 1816934..1818898 | - | 1965 | WP_279475315.1 | penicillin-binding protein 2 | - |
NYR62_RS08320 (NYR62_08320) | 1818981..1819448 | - | 468 | WP_279475316.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
NYR62_RS08325 (NYR62_08325) | 1819471..1819785 | - | 315 | WP_005619625.1 | ribosome silencing factor | - |
NYR62_RS08330 (NYR62_08330) | 1819926..1820234 | - | 309 | WP_275218140.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
NYR62_RS08335 (NYR62_08335) | 1820218..1820580 | - | 363 | WP_279475317.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR62_RS08340 (NYR62_08340) | 1820759..1823353 | - | 2595 | WP_279475318.1 | DNA mismatch repair protein MutS | - |
NYR62_RS08345 (NYR62_08345) | 1823519..1824268 | - | 750 | WP_015674150.1 | amino acid ABC transporter ATP-binding protein | - |
NYR62_RS08350 (NYR62_08350) | 1824290..1825006 | - | 717 | WP_279475319.1 | amino acid ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 14039.12 Da Isoelectric Point: 10.0989
>T256698 WP_279475317.1 NZ_CP103809:c1820580-1820218 [Actinobacillus genomosp. 1]
VKLVFVELPPFERYRQKHLSDEEYKHFQNELLENPNKGDLIQGTNGLRKIRIADMQRNKGKRGGARVIYYHIVNYSKILL
VTAYGKDEQSDLSNTERNMLANKVKRIVELEIRSCNGKTF
VKLVFVELPPFERYRQKHLSDEEYKHFQNELLENPNKGDLIQGTNGLRKIRIADMQRNKGKRGGARVIYYHIVNYSKILL
VTAYGKDEQSDLSNTERNMLANKVKRIVELEIRSCNGKTF
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|