Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
Location | 1874133..1874787 | Replicon | chromosome |
Accession | NZ_CP103808 | ||
Organism | Actinobacillus genomosp. |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NYR61_RS08730 | Protein ID | WP_278226473.1 |
Coordinates | 1874425..1874787 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYR61_RS08725 | Protein ID | WP_279453291.1 |
Coordinates | 1874133..1874441 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYR61_RS08700 (NYR61_08700) | 1869293..1869850 | - | 558 | WP_279457153.1 | septal ring lytic transglycosylase RlpA family protein | - |
NYR61_RS08705 (NYR61_08705) | 1870025..1871149 | - | 1125 | WP_279457154.1 | rod shape-determining protein RodA | - |
NYR61_RS08710 (NYR61_08710) | 1871142..1873106 | - | 1965 | WP_279468506.1 | penicillin-binding protein 2 | - |
NYR61_RS08715 (NYR61_08715) | 1873189..1873656 | - | 468 | WP_005598965.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
NYR61_RS08720 (NYR61_08720) | 1873679..1873993 | - | 315 | WP_005619625.1 | ribosome silencing factor | - |
NYR61_RS08725 (NYR61_08725) | 1874133..1874441 | - | 309 | WP_279453291.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
NYR61_RS08730 (NYR61_08730) | 1874425..1874787 | - | 363 | WP_278226473.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYR61_RS08735 (NYR61_08735) | 1874966..1877560 | - | 2595 | WP_279468507.1 | DNA mismatch repair protein MutS | - |
NYR61_RS08740 (NYR61_08740) | 1877819..1878961 | + | 1143 | WP_279468508.1 | esterase-like activity of phytase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 14067.13 Da Isoelectric Point: 10.1215
>T256693 WP_278226473.1 NZ_CP103808:c1874787-1874425 [Actinobacillus genomosp. 1]
VKLVFVELPPFERYRQKHLSDEEYRHFQNELLENPNKGDLIQGTNGLRKIRIADMQRNKGKRGGARVIYYHIVNYSKILL
VTAYGKDEQSDLSNTERNMLANKVKRIVELEIRSCNGKTF
VKLVFVELPPFERYRQKHLSDEEYRHFQNELLENPNKGDLIQGTNGLRKIRIADMQRNKGKRGGARVIYYHIVNYSKILL
VTAYGKDEQSDLSNTERNMLANKVKRIVELEIRSCNGKTF
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|