Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4440273..4440875 | Replicon | chromosome |
| Accession | NZ_CP103791 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain MRS17_00712 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | C0Q3J8 |
| Locus tag | NYQ90_RS21370 | Protein ID | WP_001159630.1 |
| Coordinates | 4440564..4440875 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NYQ90_RS21365 | Protein ID | WP_000362050.1 |
| Coordinates | 4440273..4440563 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYQ90_RS21350 (4437766) | 4437766..4438668 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NYQ90_RS21355 (4438665) | 4438665..4439300 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NYQ90_RS21360 (4439297) | 4439297..4440226 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NYQ90_RS21365 (4440273) | 4440273..4440563 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| NYQ90_RS21370 (4440564) | 4440564..4440875 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| NYQ90_RS21375 (4441093) | 4441093..4442022 | + | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
| NYQ90_RS21380 (4442108) | 4442108..4442419 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
| NYQ90_RS21385 (4442416) | 4442416..4442862 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| NYQ90_RS21390 (4442877) | 4442877..4443818 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NYQ90_RS21395 (4443863) | 4443863..4444300 | - | 438 | WP_023993693.1 | D-aminoacyl-tRNA deacylase | - |
| NYQ90_RS21400 (4444297) | 4444297..4445169 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| NYQ90_RS21405 (4445163) | 4445163..4445762 | - | 600 | WP_000965698.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T256679 WP_001159630.1 NZ_CP103791:c4440875-4440564 [Salmonella enterica subsp. enterica serovar Infantis]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT256679 WP_000362050.1 NZ_CP103791:c4440563-4440273 [Salmonella enterica subsp. enterica serovar Infantis]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|