Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 40349..40613 Replicon plasmid pS1905_1
Accession NZ_CP103772
Organism Salmonella enterica strain S1905

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag NYS49_RS24320 Protein ID WP_001387489.1
Coordinates 40461..40613 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 40349..40409 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYS49_RS24305 (36451) 36451..37521 - 1071 WP_012783932.1 IncI1-type conjugal transfer protein TrbB -
NYS49_RS24310 (37540) 37540..38748 - 1209 WP_001703845.1 IncI1-type conjugal transfer protein TrbA -
- (38928) 38928..38985 - 58 NuclAT_1 - -
- (38928) 38928..38985 - 58 NuclAT_1 - -
- (38928) 38928..38985 - 58 NuclAT_1 - -
- (38928) 38928..38985 - 58 NuclAT_1 - -
NYS49_RS24315 (39055) 39055..40140 - 1086 WP_000080543.1 protein finQ -
- (40349) 40349..40409 - 61 NuclAT_0 - Antitoxin
- (40349) 40349..40409 - 61 NuclAT_0 - Antitoxin
- (40349) 40349..40409 - 61 NuclAT_0 - Antitoxin
- (40349) 40349..40409 - 61 NuclAT_0 - Antitoxin
NYS49_RS24320 (40461) 40461..40613 + 153 WP_001387489.1 Hok/Gef family protein Toxin
NYS49_RS24325 (40685) 40685..40936 - 252 WP_001291964.1 hypothetical protein -
NYS49_RS24330 (41236) 41236..41532 + 297 WP_011264046.1 DinQ-like type I toxin DqlB -
NYS49_RS24335 (41597) 41597..41773 - 177 WP_001054900.1 hypothetical protein -
NYS49_RS24340 (42165) 42165..42374 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
NYS49_RS24345 (42446) 42446..43108 - 663 WP_012783935.1 plasmid IncI1-type surface exclusion protein ExcA -
NYS49_RS24350 (43179) 43179..45347 - 2169 WP_015508354.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 - 1..85991 85991


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T256635 WP_001387489.1 NZ_CP103772:40461-40613 [Salmonella enterica]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT256635 NZ_CP103772:c40409-40349 [Salmonella enterica]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References