Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4913382..4913984 | Replicon | chromosome |
Accession | NZ_CP103771 | ||
Organism | Salmonella enterica strain S1905 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A603E470 |
Locus tag | NYS49_RS23880 | Protein ID | WP_023138876.1 |
Coordinates | 4913382..4913693 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYS49_RS23885 | Protein ID | WP_000362050.1 |
Coordinates | 4913694..4913984 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYS49_RS23855 (4909339) | 4909339..4909938 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
NYS49_RS23860 (4909932) | 4909932..4910804 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
NYS49_RS23865 (4910801) | 4910801..4911238 | + | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
NYS49_RS23870 (4911283) | 4911283..4912224 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
NYS49_RS23875 (4912250) | 4912250..4913164 | - | 915 | WP_023138875.1 | alpha/beta hydrolase | - |
NYS49_RS23880 (4913382) | 4913382..4913693 | + | 312 | WP_023138876.1 | hypothetical protein | Toxin |
NYS49_RS23885 (4913694) | 4913694..4913984 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
NYS49_RS23890 (4914031) | 4914031..4914960 | - | 930 | WP_023138877.1 | formate dehydrogenase accessory protein FdhE | - |
NYS49_RS23895 (4914957) | 4914957..4915592 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
NYS49_RS23900 (4915589) | 4915589..4916491 | - | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12356.30 Da Isoelectric Point: 9.4460
>T256634 WP_023138876.1 NZ_CP103771:4913382-4913693 [Salmonella enterica]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|