Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2590328..2591055 | Replicon | chromosome |
Accession | NZ_CP103771 | ||
Organism | Salmonella enterica strain S1905 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A8E5IJ81 |
Locus tag | NYS49_RS12545 | Protein ID | WP_000558157.1 |
Coordinates | 2590328..2590639 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYS49_RS12550 | Protein ID | WP_000561389.1 |
Coordinates | 2590636..2591055 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYS49_RS12505 (2585372) | 2585372..2585767 | + | 396 | WP_000422887.1 | DUF1398 domain-containing protein | - |
NYS49_RS12510 (2586096) | 2586096..2586572 | + | 477 | WP_023138823.1 | hypothetical protein | - |
NYS49_RS12515 (2586724) | 2586724..2586876 | + | 153 | WP_157794946.1 | hypothetical protein | - |
NYS49_RS12520 (2586988) | 2586988..2587446 | - | 459 | WP_001195655.1 | hypothetical protein | - |
NYS49_RS12525 (2587772) | 2587772..2588919 | + | 1148 | WP_112324583.1 | IS3 family transposase | - |
NYS49_RS12530 (2588950) | 2588950..2589507 | - | 558 | WP_000179886.1 | hypothetical protein | - |
NYS49_RS12535 (2589611) | 2589611..2589820 | - | 210 | WP_023137948.1 | hypothetical protein | - |
NYS49_RS12540 (2589850) | 2589850..2590149 | - | 300 | WP_000775225.1 | hypothetical protein | - |
NYS49_RS12545 (2590328) | 2590328..2590639 | + | 312 | WP_000558157.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NYS49_RS12550 (2590636) | 2590636..2591055 | + | 420 | WP_000561389.1 | helix-turn-helix domain-containing protein | Antitoxin |
NYS49_RS12555 (2591308) | 2591308..2591960 | + | 653 | Protein_2451 | glycosyltransferase | - |
NYS49_RS12560 (2592196) | 2592196..2592615 | - | 420 | WP_023137951.1 | GNAT family N-acetyltransferase | - |
NYS49_RS12565 (2592985) | 2592985..2593254 | + | 270 | WP_077908593.1 | hypothetical protein | - |
NYS49_RS12570 (2593420) | 2593420..2593560 | + | 141 | WP_001576018.1 | hypothetical protein | - |
NYS49_RS12575 (2593706) | 2593706..2594247 | - | 542 | Protein_2455 | transposase | - |
NYS49_RS12580 (2594267) | 2594267..2594359 | - | 93 | WP_231923105.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 2587772..2594044 | 6272 | |
- | inside | Genomic island | - | sopE2 | 2583966..2594382 | 10416 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12425.26 Da Isoelectric Point: 10.1376
>T256625 WP_000558157.1 NZ_CP103771:2590328-2590639 [Salmonella enterica]
MHVISKEPFDEAARRYPNDSLAIKALYRLVREKDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
MHVISKEPFDEAARRYPNDSLAIKALYRLVREKDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15301.49 Da Isoelectric Point: 4.6286
>AT256625 WP_000561389.1 NZ_CP103771:2590636-2591055 [Salmonella enterica]
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|