Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 31594..32240 | Replicon | plasmid pMB9880_3 |
Accession | NZ_CP103765 | ||
Organism | Escherichia coli strain 5283 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A3P1YQM6 |
Locus tag | M5T11_RS26275 | Protein ID | WP_025667955.1 |
Coordinates | 31594..31941 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1V3UZT0 |
Locus tag | M5T11_RS26280 | Protein ID | WP_001259436.1 |
Coordinates | 31941..32240 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T11_RS26245 (M5T11_26245) | 27086..27364 | + | 279 | WP_032152803.1 | hypothetical protein | - |
M5T11_RS26250 (M5T11_26250) | 27374..28414 | + | 1041 | WP_251296402.1 | phage tail protein | - |
M5T11_RS26255 (M5T11_26255) | 28416..28943 | + | 528 | WP_032152674.1 | tail fiber assembly protein | - |
M5T11_RS26260 (M5T11_26260) | 29151..30131 | + | 981 | WP_241336524.1 | plasmid replication initiator RepA | - |
M5T11_RS26265 (M5T11_26265) | 30775..31062 | + | 288 | WP_032152672.1 | hypothetical protein | - |
M5T11_RS26270 (M5T11_26270) | 31086..31349 | + | 264 | WP_000424604.1 | hypothetical protein | - |
M5T11_RS26275 (M5T11_26275) | 31594..31941 | + | 348 | WP_025667955.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5T11_RS26280 (M5T11_26280) | 31941..32240 | + | 300 | WP_001259436.1 | XRE family transcriptional regulator | Antitoxin |
M5T11_RS26285 (M5T11_26285) | 32405..32785 | + | 381 | WP_000061763.1 | hypothetical protein | - |
M5T11_RS26290 (M5T11_26290) | 32849..33121 | + | 273 | WP_000148349.1 | helix-turn-helix domain-containing protein | - |
M5T11_RS26295 (M5T11_26295) | 33732..33920 | + | 189 | WP_004105254.1 | hypothetical protein | - |
M5T11_RS26300 (M5T11_26300) | 33931..35112 | - | 1182 | WP_116290193.1 | ORF6N domain-containing protein | - |
M5T11_RS26305 (M5T11_26305) | 35109..35354 | - | 246 | WP_250143293.1 | hypothetical protein | - |
M5T11_RS26310 (M5T11_26310) | 35331..35570 | - | 240 | Protein_45 | ash family protein | - |
M5T11_RS26315 (M5T11_26315) | 36431..36679 | - | 249 | WP_000730008.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..48945 | 48945 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13530.50 Da Isoelectric Point: 9.3634
>T256612 WP_025667955.1 NZ_CP103765:31594-31941 [Escherichia coli]
MWTVLFSQRFDDWLNEQEDALQEKVLADLKNLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYKKLVRIAEDEFAAHLNTLESK
MWTVLFSQRFDDWLNEQEDALQEKVLADLKNLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYKKLVRIAEDEFAAHLNTLESK
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3P1YQM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V3UZT0 |