Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 83775..84015 | Replicon | plasmid pMB9880_1 |
| Accession | NZ_CP103763 | ||
| Organism | Escherichia coli strain 5283 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M5T11_RS25315 | Protein ID | WP_001372321.1 |
| Coordinates | 83775..83900 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 83977..84015 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T11_RS25270 (78887) | 78887..79114 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| M5T11_RS25275 (79202) | 79202..79879 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| M5T11_RS25280 (80013) | 80013..80396 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M5T11_RS25285 (80727) | 80727..81329 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| M5T11_RS25290 (81626) | 81626..82447 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| M5T11_RS25295 (82566) | 82566..82853 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| M5T11_RS25300 (82878) | 82878..83084 | - | 207 | WP_024190427.1 | hypothetical protein | - |
| M5T11_RS25305 (83154) | 83154..83327 | + | 174 | Protein_106 | hypothetical protein | - |
| M5T11_RS25310 (83325) | 83325..83555 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| M5T11_RS25315 (83775) | 83775..83900 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M5T11_RS25320 (83842) | 83842..83991 | - | 150 | Protein_109 | plasmid maintenance protein Mok | - |
| - (83977) | 83977..84015 | - | 39 | NuclAT_1 | - | Antitoxin |
| - (83977) | 83977..84015 | - | 39 | NuclAT_1 | - | Antitoxin |
| - (83977) | 83977..84015 | - | 39 | NuclAT_1 | - | Antitoxin |
| - (83977) | 83977..84015 | - | 39 | NuclAT_1 | - | Antitoxin |
| - (85455) | 85455..85557 | - | 103 | NuclAT_0 | - | - |
| - (85455) | 85455..85557 | - | 103 | NuclAT_0 | - | - |
| - (85455) | 85455..85557 | - | 103 | NuclAT_0 | - | - |
| - (85455) | 85455..85557 | - | 103 | NuclAT_0 | - | - |
| M5T11_RS25330 (85526) | 85526..86288 | - | 763 | Protein_111 | plasmid SOS inhibition protein A | - |
| M5T11_RS25335 (86285) | 86285..86719 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| M5T11_RS25340 (86774) | 86774..88732 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | tet(B) / dfrA17 / aadA5 / qacE / sul1 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / aac(3)-IId / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..128773 | 128773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T256606 WP_001372321.1 NZ_CP103763:c83900-83775 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 39 bp
>AT256606 NZ_CP103763:c84015-83977 [Escherichia coli]
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
