Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 38356..38595 Replicon plasmid pMB9880_1
Accession NZ_CP103763
Organism Escherichia coli strain 5283

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag M5T11_RS25035 Protein ID WP_023144756.1
Coordinates 38356..38490 (-) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 38535..38595 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T11_RS25005 (34057) 34057..34914 - 858 WP_000130640.1 incFII family plasmid replication initiator RepA -
M5T11_RS25010 (34907) 34907..34981 - 75 WP_031943482.1 RepA leader peptide Tap -
M5T11_RS25015 (34981) 34981..35112 - 132 Protein_48 protein CopA/IncA -
M5T11_RS25020 (35343) 35343..36884 + 1542 WP_002431311.1 IS21-like element ISEc12 family transposase -
M5T11_RS25025 (36899) 36899..37645 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
M5T11_RS25030 (37805) 37805..38059 - 255 WP_000083850.1 replication regulatory protein RepA -
M5T11_RS25035 (38356) 38356..38490 - 135 WP_023144756.1 Hok/Gef family protein Toxin
- (38535) 38535..38595 + 61 NuclAT_2 - Antitoxin
- (38535) 38535..38595 + 61 NuclAT_2 - Antitoxin
- (38535) 38535..38595 + 61 NuclAT_2 - Antitoxin
- (38535) 38535..38595 + 61 NuclAT_2 - Antitoxin
M5T11_RS25040 (38562) 38562..38848 - 287 Protein_53 DUF2726 domain-containing protein -
M5T11_RS25045 (39361) 39361..39573 - 213 WP_013023861.1 hypothetical protein -
M5T11_RS25050 (39704) 39704..40264 - 561 WP_000139341.1 fertility inhibition protein FinO -
M5T11_RS25055 (40319) 40319..41065 - 747 WP_000205718.1 conjugal transfer pilus acetylase TraX -
M5T11_RS25060 (41085) 41085..43541 - 2457 Protein_57 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid tet(B) / dfrA17 / aadA5 / qacE / sul1 / blaTEM-1B / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / aac(3)-IId / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 - 1..128773 128773


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T256605 WP_023144756.1 NZ_CP103763:c38490-38356 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT256605 NZ_CP103763:38535-38595 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References