Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4912204..4912806 | Replicon | chromosome |
Accession | NZ_CP103762 | ||
Organism | Escherichia coli strain 5283 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | M5T11_RS23795 | Protein ID | WP_000897305.1 |
Coordinates | 4912495..4912806 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5T11_RS23790 | Protein ID | WP_000356395.1 |
Coordinates | 4912204..4912494 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T11_RS23755 (4907827) | 4907827..4908729 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
M5T11_RS23760 (4908726) | 4908726..4909361 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5T11_RS23765 (4909358) | 4909358..4910287 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
M5T11_RS23770 (4910469) | 4910469..4910711 | - | 243 | WP_021523315.1 | hypothetical protein | - |
M5T11_RS23775 (4910930) | 4910930..4911148 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
M5T11_RS23780 (4911567) | 4911567..4911845 | - | 279 | WP_001306650.1 | hypothetical protein | - |
M5T11_RS23785 (4911907) | 4911907..4912119 | - | 213 | WP_000197769.1 | hypothetical protein | - |
M5T11_RS23790 (4912204) | 4912204..4912494 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
M5T11_RS23795 (4912495) | 4912495..4912806 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
M5T11_RS23800 (4913035) | 4913035..4913943 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
M5T11_RS23805 (4914112) | 4914112..4915026 | - | 915 | WP_077634137.1 | transposase | - |
M5T11_RS23810 (4915039) | 4915039..4915926 | - | 888 | Protein_4654 | hypothetical protein | - |
M5T11_RS23815 (4916342) | 4916342..4917283 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
M5T11_RS23820 (4917328) | 4917328..4917765 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T256604 WP_000897305.1 NZ_CP103762:c4912806-4912495 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|