Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3948846..3949540 Replicon chromosome
Accession NZ_CP103762
Organism Escherichia coli strain 5283

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag M5T11_RS19190 Protein ID WP_001521903.1
Coordinates 3948846..3949244 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag M5T11_RS19195 Protein ID WP_000554758.1
Coordinates 3949247..3949540 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3944676) 3944676..3944756 - 81 NuclAT_11 - -
- (3944676) 3944676..3944756 - 81 NuclAT_11 - -
- (3944676) 3944676..3944756 - 81 NuclAT_11 - -
- (3944676) 3944676..3944756 - 81 NuclAT_11 - -
M5T11_RS19160 (3944016) 3944016..3945260 - 1245 WP_000189541.1 esterase FrsA -
M5T11_RS19165 (3945352) 3945352..3945810 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
M5T11_RS19170 (3946071) 3946071..3947528 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
M5T11_RS19175 (3947585) 3947585..3947937 - 353 Protein_3754 peptide chain release factor H -
M5T11_RS19180 (3947933) 3947933..3948139 - 207 Protein_3755 RtcB family protein -
M5T11_RS19185 (3948384) 3948384..3948836 - 453 WP_023144376.1 GNAT family N-acetyltransferase -
M5T11_RS19190 (3948846) 3948846..3949244 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
M5T11_RS19195 (3949247) 3949247..3949540 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
M5T11_RS19200 (3949592) 3949592..3950647 - 1056 WP_001226177.1 DNA polymerase IV -
M5T11_RS19205 (3950718) 3950718..3951503 - 786 WP_000207556.1 putative lateral flagellar export/assembly protein LafU -
M5T11_RS19210 (3951475) 3951475..3953187 + 1713 Protein_3761 flagellar biosynthesis protein FlhA -
M5T11_RS19215 (3953266) 3953266..3953619 + 354 WP_024166466.1 type II toxin-antitoxin system HicB family antitoxin -
M5T11_RS19220 (3953676) 3953676..3954425 - 750 WP_016233951.1 C40 family peptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3938783..3949540 10757


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T256598 WP_001521903.1 NZ_CP103762:c3949244-3948846 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT256598 WP_000554758.1 NZ_CP103762:c3949540-3949247 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References