Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 93544..93902 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP103759 | ||
| Organism | Escherichia coli strain p10B | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NYO15_RS23725 | Protein ID | WP_233329041.1 |
| Coordinates | 93544..93642 (-) | Length | 33 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 93754..93902 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO15_RS23695 (89104) | 89104..89706 | + | 603 | WP_072156291.1 | transglycosylase SLT domain-containing protein | - |
| NYO15_RS23700 (90003) | 90003..90824 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| NYO15_RS23705 (90943) | 90943..91230 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| NYO15_RS23710 (91481) | 91481..92485 | + | 1005 | WP_024257664.1 | IS110 family transposase | - |
| NYO15_RS23715 (92579) | 92579..92839 | - | 261 | WP_244586445.1 | single-stranded DNA-binding protein | - |
| NYO15_RS23720 (92909) | 92909..93081 | + | 173 | Protein_111 | hypothetical protein | - |
| NYO15_RS23725 (93544) | 93544..93642 | - | 99 | WP_233329041.1 | Hok/Gef family protein | Toxin |
| NYO15_RS23730 (93611) | 93611..93688 | - | 78 | Protein_113 | DUF5431 family protein | - |
| - (93754) | 93754..93902 | - | 149 | NuclAT_0 | - | Antitoxin |
| - (93754) | 93754..93902 | - | 149 | NuclAT_0 | - | Antitoxin |
| - (93754) | 93754..93902 | - | 149 | NuclAT_0 | - | Antitoxin |
| - (93754) | 93754..93902 | - | 149 | NuclAT_0 | - | Antitoxin |
| NYO15_RS23735 (93878) | 93878..94153 | - | 276 | WP_077631319.1 | hypothetical protein | - |
| NYO15_RS23740 (94217) | 94217..95788 | - | 1572 | WP_099588291.1 | IS66-like element ISCro1 family transposase | - |
| NYO15_RS23745 (95808) | 95808..96155 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NYO15_RS23750 (96155) | 96155..96802 | - | 648 | WP_001295212.1 | IS66-like element accessory protein TnpA | - |
| NYO15_RS23755 (96863) | 96863..97639 | + | 777 | WP_099588290.1 | thiosulfate reductase cytochrome B subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / tet(A) / aph(3')-Ia / aac(3)-IIa / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..132213 | 132213 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 33 a.a. Molecular weight: 3808.36 Da Isoelectric Point: 7.9707
>T256577 WP_233329041.1 NZ_CP103759:c93642-93544 [Escherichia coli]
MFTYLTRKSLCEIRYRDGDREVAAFMAYESGK
MFTYLTRKSLCEIRYRDGDREVAAFMAYESGK
Download Length: 99 bp
Antitoxin
Download Length: 149 bp
>AT256577 NZ_CP103759:c93902-93754 [Escherichia coli]
CAGGGTGCAGACATATGGGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGT
GTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGCATCCCATATGTCT
CAGGGTGCAGACATATGGGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGT
GTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGCATCCCATATGTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
