Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 53821..54075 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP103759 | ||
| Organism | Escherichia coli strain p10B | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NYO15_RS23490 | Protein ID | WP_001312851.1 |
| Coordinates | 53821..53970 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 54014..54075 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO15_RS23450 (49373) | 49373..49774 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NYO15_RS23455 (49707) | 49707..49964 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NYO15_RS23460 (50057) | 50057..50710 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NYO15_RS23465 (51649) | 51649..52506 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| NYO15_RS23470 (52499) | 52499..52981 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| NYO15_RS23475 (52974) | 52974..53021 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| NYO15_RS23480 (53012) | 53012..53263 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| NYO15_RS23485 (53280) | 53280..53537 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| NYO15_RS23490 (53821) | 53821..53970 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (54014) | 54014..54075 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (54014) | 54014..54075 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (54014) | 54014..54075 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (54014) | 54014..54075 | + | 62 | NuclAT_1 | - | Antitoxin |
| NYO15_RS23495 (54331) | 54331..54405 | - | 75 | Protein_66 | endonuclease | - |
| NYO15_RS23500 (54651) | 54651..54863 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| NYO15_RS23505 (54999) | 54999..55559 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| NYO15_RS23510 (55662) | 55662..56522 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| NYO15_RS23515 (56581) | 56581..57327 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / tet(A) / aph(3')-Ia / aac(3)-IIa / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..132213 | 132213 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T256575 WP_001312851.1 NZ_CP103759:c53970-53821 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT256575 NZ_CP103759:54014-54075 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
