Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3675084..3675778 | Replicon | chromosome |
| Accession | NZ_CP103758 | ||
| Organism | Escherichia coli strain p10B | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | NYO15_RS18075 | Protein ID | WP_001263489.1 |
| Coordinates | 3675084..3675482 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | NYO15_RS18080 | Protein ID | WP_000554758.1 |
| Coordinates | 3675485..3675778 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3670672) | 3670672..3670752 | - | 81 | NuclAT_10 | - | - |
| - (3670672) | 3670672..3670752 | - | 81 | NuclAT_10 | - | - |
| - (3670672) | 3670672..3670752 | - | 81 | NuclAT_10 | - | - |
| - (3670672) | 3670672..3670752 | - | 81 | NuclAT_10 | - | - |
| NYO15_RS18050 (3671348) | 3671348..3671806 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| NYO15_RS18055 (3672067) | 3672067..3673524 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| NYO15_RS18060 (3673581) | 3673581..3674102 | - | 522 | Protein_3530 | peptide chain release factor H | - |
| NYO15_RS18065 (3674098) | 3674098..3674304 | - | 207 | Protein_3531 | RtcB family protein | - |
| NYO15_RS18070 (3674622) | 3674622..3675074 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| NYO15_RS18075 (3675084) | 3675084..3675482 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NYO15_RS18080 (3675485) | 3675485..3675778 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NYO15_RS18085 (3675830) | 3675830..3676885 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| NYO15_RS18090 (3676956) | 3676956..3677741 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| NYO15_RS18095 (3677713) | 3677713..3679425 | + | 1713 | Protein_3537 | flagellar biosynthesis protein FlhA | - |
| NYO15_RS18100 (3679649) | 3679649..3680146 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T256571 WP_001263489.1 NZ_CP103758:c3675482-3675084 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |