Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 689540..690233 | Replicon | chromosome |
Accession | NZ_CP103758 | ||
Organism | Escherichia coli strain p10B |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | U9ZN09 |
Locus tag | NYO15_RS03380 | Protein ID | WP_000415585.1 |
Coordinates | 689540..689836 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | NYO15_RS03385 | Protein ID | WP_000650107.1 |
Coordinates | 689838..690233 (+) | Length | 132 a.a. |
Genomic Context
Location: 684674..685153 (480 bp)
Type: Others
Protein ID: WP_000065332.1
Type: Others
Protein ID: WP_000065332.1
Location: 685156..685866 (711 bp)
Type: Others
Protein ID: WP_000834030.1
Type: Others
Protein ID: WP_000834030.1
Location: 685873..686205 (333 bp)
Type: Others
Protein ID: WP_000914690.1
Type: Others
Protein ID: WP_000914690.1
Location: 688408..688800 (393 bp)
Type: Others
Protein ID: WP_000712658.1
Type: Others
Protein ID: WP_000712658.1
Location: 688853..689335 (483 bp)
Type: Others
Protein ID: WP_000183505.1
Type: Others
Protein ID: WP_000183505.1
Location: 689540..689836 (297 bp)
Type: Toxin
Protein ID: WP_000415585.1
Type: Toxin
Protein ID: WP_000415585.1
Location: 689838..690233 (396 bp)
Type: Antitoxin
Protein ID: WP_000650107.1
Type: Antitoxin
Protein ID: WP_000650107.1
Location: 690366..691973 (1608 bp)
Type: Others
Protein ID: WP_001375094.1
Type: Others
Protein ID: WP_001375094.1
Location: 692111..694369 (2259 bp)
Type: Others
Protein ID: WP_001281841.1
Type: Others
Protein ID: WP_001281841.1
Location: 686251..687600 (1350 bp)
Type: Others
Protein ID: WP_000673358.1
Type: Others
Protein ID: WP_000673358.1
Location: 687597..688256 (660 bp)
Type: Others
Protein ID: WP_001221502.1
Type: Others
Protein ID: WP_001221502.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYO15_RS03345 (684674) | 684674..685153 | + | 480 | WP_000065332.1 | Hcp family type VI secretion system effector | - |
NYO15_RS03350 (685156) | 685156..685866 | + | 711 | WP_000834030.1 | hypothetical protein | - |
NYO15_RS03355 (685873) | 685873..686205 | + | 333 | WP_000914690.1 | DUF2645 family protein | - |
NYO15_RS03360 (686251) | 686251..687600 | - | 1350 | WP_000673358.1 | quorum sensing histidine kinase QseC | - |
NYO15_RS03365 (687597) | 687597..688256 | - | 660 | WP_001221502.1 | quorum sensing response regulator transcription factor QseB | - |
NYO15_RS03370 (688408) | 688408..688800 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
NYO15_RS03375 (688853) | 688853..689335 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
NYO15_RS03380 (689540) | 689540..689836 | + | 297 | WP_000415585.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
NYO15_RS03385 (689838) | 689838..690233 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
NYO15_RS03390 (690366) | 690366..691973 | + | 1608 | WP_001375094.1 | ABC transporter substrate-binding protein | - |
NYO15_RS03395 (692111) | 692111..694369 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11261.99 Da Isoelectric Point: 8.9070
>T256560 WP_000415585.1 NZ_CP103758:689540-689836 [Escherichia coli]
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT256560 WP_000650107.1 NZ_CP103758:689838-690233 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp