Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 62553..62807 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP103756 | ||
| Organism | Escherichia coli strain p11B | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NYO14_RS26600 | Protein ID | WP_001312851.1 |
| Coordinates | 62658..62807 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 62553..62614 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO14_RS26565 (58205) | 58205..58417 | + | 213 | WP_005012601.1 | hypothetical protein | - |
| NYO14_RS26570 (58718) | 58718..58807 | - | 90 | Protein_73 | IS1 family transposase | - |
| NYO14_RS26575 (58862) | 58862..59539 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| NYO14_RS26580 (59539) | 59539..59886 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NYO14_RS26585 (59906) | 59906..61477 | + | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| NYO14_RS26590 (61515) | 61515..62131 | - | 617 | Protein_77 | IS1-like element IS1A family transposase | - |
| NYO14_RS26595 (62232) | 62232..62414 | + | 183 | WP_000968309.1 | hypothetical protein | - |
| - (62553) | 62553..62614 | - | 62 | NuclAT_2 | - | Antitoxin |
| - (62553) | 62553..62614 | - | 62 | NuclAT_2 | - | Antitoxin |
| - (62553) | 62553..62614 | - | 62 | NuclAT_2 | - | Antitoxin |
| - (62553) | 62553..62614 | - | 62 | NuclAT_2 | - | Antitoxin |
| NYO14_RS26600 (62658) | 62658..62807 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NYO14_RS26605 (63091) | 63091..63348 | + | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| NYO14_RS26610 (63584) | 63584..63658 | + | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| NYO14_RS26615 (63651) | 63651..64097 | + | 447 | Protein_82 | plasmid replication initiator RepA | - |
| NYO14_RS26620 (64097) | 64097..64711 | - | 615 | Protein_83 | VENN motif pre-toxin domain-containing protein | - |
| NYO14_RS26625 (65418) | 65418..66638 | + | 1221 | WP_000410951.1 | arginine deiminase | - |
| NYO14_RS26630 (66649) | 66649..67560 | + | 912 | WP_000440183.1 | carbamate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 | senB | 1..180962 | 180962 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T256551 WP_001312851.1 NZ_CP103756:62658-62807 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT256551 NZ_CP103756:c62614-62553 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|