Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 19926..20159 Replicon plasmid unnamed1
Accession NZ_CP103756
Organism Escherichia coli strain p11B

Toxin (Protein)


Gene name hok Uniprot ID G9G195
Locus tag NYO14_RS26345 Protein ID WP_001323520.1
Coordinates 20043..20159 (+) Length 39 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 19926..19957 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYO14_RS26305 (16047) 16047..16544 + 498 WP_042039995.1 single-stranded DNA-binding protein -
NYO14_RS26310 (16612) 16612..16845 + 234 WP_000005990.1 DUF905 family protein -
NYO14_RS26315 (16873) 16873..17070 + 198 Protein_22 hypothetical protein -
NYO14_RS26320 (17125) 17125..17559 + 435 WP_000845937.1 conjugation system SOS inhibitor PsiB -
NYO14_RS26325 (17556) 17556..18318 + 763 Protein_24 plasmid SOS inhibition protein A -
NYO14_RS26330 (18287) 18287..18475 - 189 WP_001299721.1 hypothetical protein -
- (18287) 18287..18484 + 198 NuclAT_0 - -
- (18287) 18287..18484 + 198 NuclAT_0 - -
- (18287) 18287..18484 + 198 NuclAT_0 - -
- (18287) 18287..18484 + 198 NuclAT_0 - -
NYO14_RS26335 (18532) 18532..19901 + 1370 WP_085947770.1 IS3-like element IS150 family transposase -
- (19926) 19926..19957 + 32 NuclAT_1 - Antitoxin
- (19926) 19926..19957 + 32 NuclAT_1 - Antitoxin
- (19926) 19926..19957 + 32 NuclAT_1 - Antitoxin
- (19926) 19926..19957 + 32 NuclAT_1 - Antitoxin
NYO14_RS26340 (19943) 19943..20092 + 150 Protein_27 plasmid maintenance protein Mok -
NYO14_RS26345 (20043) 20043..20159 + 117 WP_001323520.1 type I toxin-antitoxin system Hok family toxin Toxin
NYO14_RS26350 (20379) 20379..20609 + 231 WP_071886920.1 hypothetical protein -
NYO14_RS26355 (20607) 20607..20779 - 173 Protein_30 hypothetical protein -
NYO14_RS26360 (20849) 20849..21055 + 207 WP_000547968.1 hypothetical protein -
NYO14_RS26365 (21080) 21080..21367 + 288 WP_000107535.1 hypothetical protein -
NYO14_RS26370 (21485) 21485..22306 + 822 WP_001234426.1 DUF932 domain-containing protein -
NYO14_RS26375 (22603) 22603..23205 - 603 WP_013362798.1 transglycosylase SLT domain-containing protein -
NYO14_RS26380 (23526) 23526..23909 + 384 WP_001151524.1 conjugal transfer relaxosome DNA-binding protein TraM -
NYO14_RS26385 (24096) 24096..24785 + 690 WP_000283385.1 conjugal transfer transcriptional regulator TraJ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 senB 1..180962 180962


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(1-34)


Sequences

Toxin        


Download         Length: 39 a.a.        Molecular weight: 4455.23 Da        Isoelectric Point: 8.5110

>T256548 WP_001323520.1 NZ_CP103756:20043-20159 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Download         Length: 117 bp

Antitoxin


Download         Length: 32 bp

>AT256548 NZ_CP103756:19926-19957 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G9G195

Antitoxin

Download structure file

References