Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 5084841..5085443 | Replicon | chromosome |
| Accession | NZ_CP103755 | ||
| Organism | Escherichia coli strain p11B | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | NYO14_RS25190 | Protein ID | WP_000897302.1 |
| Coordinates | 5085132..5085443 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NYO14_RS25185 | Protein ID | WP_000356397.1 |
| Coordinates | 5084841..5085131 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO14_RS25155 (5080148) | 5080148..5081077 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
| NYO14_RS25160 (5081259) | 5081259..5081501 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| NYO14_RS25165 (5081791) | 5081791..5082639 | + | 849 | WP_001038650.1 | hypothetical protein | - |
| NYO14_RS25170 (5082664) | 5082664..5083404 | + | 741 | WP_000608806.1 | hypothetical protein | - |
| NYO14_RS25175 (5083589) | 5083589..5083807 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| NYO14_RS25180 (5084204) | 5084204..5084482 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| NYO14_RS25185 (5084841) | 5084841..5085131 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| NYO14_RS25190 (5085132) | 5085132..5085443 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| NYO14_RS25195 (5085672) | 5085672..5086580 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| NYO14_RS25200 (5086644) | 5086644..5087585 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NYO14_RS25205 (5087630) | 5087630..5088067 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| NYO14_RS25210 (5088064) | 5088064..5088936 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| NYO14_RS25215 (5088930) | 5088930..5089529 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T256547 WP_000897302.1 NZ_CP103755:c5085443-5085132 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|