Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3774219..3774898 | Replicon | chromosome |
| Accession | NZ_CP103755 | ||
| Organism | Escherichia coli strain p11B | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | NYO14_RS18965 | Protein ID | WP_000057523.1 |
| Coordinates | 3774596..3774898 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | NYO14_RS18960 | Protein ID | WP_000806442.1 |
| Coordinates | 3774219..3774560 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO14_RS18950 (3770463) | 3770463..3771395 | - | 933 | WP_000883041.1 | glutaminase A | - |
| NYO14_RS18955 (3771657) | 3771657..3774161 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| NYO14_RS18960 (3774219) | 3774219..3774560 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| NYO14_RS18965 (3774596) | 3774596..3774898 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYO14_RS18970 (3775031) | 3775031..3775825 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| NYO14_RS18975 (3776029) | 3776029..3776508 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| NYO14_RS18980 (3776676) | 3776676..3777332 | + | 657 | WP_015674862.1 | hypothetical protein | - |
| NYO14_RS18985 (3777329) | 3777329..3777832 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| NYO14_RS18990 (3777870) | 3777870..3779522 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T256538 WP_000057523.1 NZ_CP103755:c3774898-3774596 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|