Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 641972..642699 | Replicon | chromosome |
Accession | NZ_CP103755 | ||
Organism | Escherichia coli strain p11B |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | NYO14_RS03180 | Protein ID | WP_000550189.1 |
Coordinates | 641972..642286 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NYO14_RS03185 | Protein ID | WP_000560269.1 |
Coordinates | 642283..642699 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYO14_RS03160 (638129) | 638129..639115 | - | 987 | WP_001385498.1 | Gfo/Idh/MocA family oxidoreductase | - |
NYO14_RS03165 (639194) | 639194..639886 | - | 693 | WP_000942551.1 | vancomycin high temperature exclusion protein | - |
NYO14_RS03170 (639963) | 639963..640466 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
NYO14_RS03175 (640551) | 640551..641687 | + | 1137 | WP_000018703.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
NYO14_RS03180 (641972) | 641972..642286 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
NYO14_RS03185 (642283) | 642283..642699 | + | 417 | WP_000560269.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
NYO14_RS03190 (642744) | 642744..644762 | - | 2019 | WP_000121413.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
NYO14_RS03195 (644988) | 644988..647339 | - | 2352 | WP_000695432.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T256528 WP_000550189.1 NZ_CP103755:641972-642286 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15023.47 Da Isoelectric Point: 4.4547
>AT256528 WP_000560269.1 NZ_CP103755:642283-642699 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|