Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 33853..34117 | Replicon | plasmid pMB2791_3 |
Accession | NZ_CP103748 | ||
Organism | Escherichia coli strain 3090 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | M5T02_RS25110 | Protein ID | WP_001387489.1 |
Coordinates | 33853..34005 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 34057..34117 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T02_RS25080 (30862) | 30862..30960 | + | 99 | Protein_35 | ethanolamine utilization protein EutE | - |
M5T02_RS25085 (31032) | 31032..31241 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
M5T02_RS25090 (31633) | 31633..31809 | + | 177 | WP_001054897.1 | hypothetical protein | - |
M5T02_RS25095 (31874) | 31874..32170 | - | 297 | WP_011264046.1 | DinQ-like type I toxin DqlB | - |
M5T02_RS25100 (32459) | 32459..33376 | + | 918 | WP_000520337.1 | IS5-like element ISEc35 family transposase | - |
M5T02_RS25105 (33530) | 33530..33781 | + | 252 | WP_001291964.1 | hypothetical protein | - |
M5T02_RS25110 (33853) | 33853..34005 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
- (34057) | 34057..34117 | + | 61 | NuclAT_0 | - | Antitoxin |
- (34057) | 34057..34117 | + | 61 | NuclAT_0 | - | Antitoxin |
- (34057) | 34057..34117 | + | 61 | NuclAT_0 | - | Antitoxin |
- (34057) | 34057..34117 | + | 61 | NuclAT_0 | - | Antitoxin |
M5T02_RS25115 (34326) | 34326..34700 | + | 375 | WP_223349261.1 | hypothetical protein | - |
M5T02_RS25120 (34853) | 34853..36010 | + | 1158 | Protein_43 | IS1380-like element ISEcp1 family transposase | - |
M5T02_RS25125 (36066) | 36066..36763 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
M5T02_RS25130 (36774) | 36774..37082 | - | 309 | WP_039023235.1 | transcription termination/antitermination NusG family protein | - |
M5T02_RS25135 (37524) | 37524..37811 | - | 288 | WP_000074855.1 | conjugal transfer protein TraA | - |
M5T02_RS25140 (37729) | 37729..38007 | - | 279 | WP_219334566.1 | ash family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCMY-42 | - | 1..50937 | 50937 | |
- | inside | IScluster/Tn | blaCMY-42 | - | 28512..36341 | 7829 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T256507 WP_001387489.1 NZ_CP103748:c34005-33853 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT256507 NZ_CP103748:34057-34117 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|