Detailed information of TA system TA256505

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 85210..85479
• Replicon: plasmid pMB2791_2
• Accession: NZ_CP103747
• Organism: Escherichia coli strain 3090

Toxin (Protein)

• Gene name: hok
• Uniprot ID: G9G195
• Locus tag: M5T02_RS24875
• Protein ID: WP_001323520.1
• Coordinates: 85363..85479 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	85210..85275 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5T02_RS24840	80962..81447	+	486	WP_031311812.1	single-stranded DNA-binding protein	-
M5T02_RS24845	81505..81738	+	234	WP_000006003.1	DUF905 family protein	-
M5T02_RS24850	81799..83822	+	2024	Protein_103	ParB/RepB/Spo0J family partition protein	-
M5T02_RS24855	83891..84325	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
M5T02_RS24860	84322..85084	+	763	Protein_105	plasmid SOS inhibition protein A	-
-	85053..85277	+	225	NuclAT_0	-	-
-	85053..85277	+	225	NuclAT_0	-	-
-	85053..85277	+	225	NuclAT_0	-	-
-	85053..85277	+	225	NuclAT_0	-	-
M5T02_RS24865	85062..85241	-	180	WP_001309233.1	hypothetical protein	-
-	85210..85275	-	66	-	-	Antitoxin
M5T02_RS24870	85263..85412	+	150	Protein_107	plasmid maintenance protein Mok	-
M5T02_RS24875	85363..85479	+	117	WP_001323520.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5T02_RS24880	85798..86094	-	297	Protein_109	hypothetical protein	-
M5T02_RS24885	86394..86690	+	297	WP_001272251.1	hypothetical protein	-
M5T02_RS24890	86801..87622	+	822	WP_001234445.1	DUF932 domain-containing protein	-
M5T02_RS24895	87919..88509	-	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
M5T02_RS24900	88844..89227	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	erm(B) / mph(A)	-	1..89420	89420

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (1-34)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4455.23 Da
• Isoelectric Point: 8.5110

>T256505 WP_001323520.1 NZ_CP103747:85363-85479 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 117 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT256505 NZ_CP103747:c85275-85210 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Toxin

• AlphaFold DB: G9G195

Antitoxin