Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3853718..3854412 | Replicon | chromosome |
| Accession | NZ_CP103745 | ||
| Organism | Escherichia coli strain 3090 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | M5T02_RS18710 | Protein ID | WP_001263489.1 |
| Coordinates | 3853718..3854116 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | M5T02_RS18715 | Protein ID | WP_000554758.1 |
| Coordinates | 3854119..3854412 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3849306) | 3849306..3849386 | - | 81 | NuclAT_11 | - | - |
| - (3849306) | 3849306..3849386 | - | 81 | NuclAT_11 | - | - |
| - (3849306) | 3849306..3849386 | - | 81 | NuclAT_11 | - | - |
| - (3849306) | 3849306..3849386 | - | 81 | NuclAT_11 | - | - |
| M5T02_RS18685 (3849982) | 3849982..3850440 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| M5T02_RS18690 (3850701) | 3850701..3852158 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| M5T02_RS18695 (3852215) | 3852215..3852736 | - | 522 | Protein_3659 | peptide chain release factor H | - |
| M5T02_RS18700 (3852732) | 3852732..3852938 | - | 207 | Protein_3660 | RtcB family protein | - |
| M5T02_RS18705 (3853256) | 3853256..3853708 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| M5T02_RS18710 (3853718) | 3853718..3854116 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| M5T02_RS18715 (3854119) | 3854119..3854412 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| M5T02_RS18720 (3854464) | 3854464..3855519 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| M5T02_RS18725 (3855590) | 3855590..3856375 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| M5T02_RS18730 (3856347) | 3856347..3858059 | + | 1713 | Protein_3666 | flagellar biosynthesis protein FlhA | - |
| M5T02_RS18735 (3858283) | 3858283..3858780 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T256488 WP_001263489.1 NZ_CP103745:c3854116-3853718 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |