Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 652448..653175 | Replicon | chromosome |
Accession | NZ_CP103745 | ||
Organism | Escherichia coli strain 3090 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | M5T02_RS03200 | Protein ID | WP_000550189.1 |
Coordinates | 652448..652762 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5T02_RS03205 | Protein ID | WP_000560266.1 |
Coordinates | 652759..653175 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T02_RS03180 (648606) | 648606..649592 | - | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
M5T02_RS03185 (649671) | 649671..650363 | - | 693 | WP_000942548.1 | vancomycin high temperature exclusion protein | - |
M5T02_RS03190 (650440) | 650440..650943 | - | 504 | WP_001333820.1 | M48 family metallopeptidase | - |
M5T02_RS03195 (651028) | 651028..652164 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
M5T02_RS03200 (652448) | 652448..652762 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
M5T02_RS03205 (652759) | 652759..653175 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
M5T02_RS03210 (653220) | 653220..655238 | - | 2019 | WP_000121435.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
M5T02_RS03215 (655664) | 655664..658015 | - | 2352 | WP_000695487.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T256473 WP_000550189.1 NZ_CP103745:652448-652762 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT256473 WP_000560266.1 NZ_CP103745:652759-653175 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|