Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 48543..48782 | Replicon | plasmid pMB2855_1 |
| Accession | NZ_CP103743 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 2822 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | M5R22_RS24035 | Protein ID | WP_023144756.1 |
| Coordinates | 48648..48782 (+) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 48543..48603 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R22_RS24005 (44334) | 44334..44894 | + | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| M5R22_RS24010 (45025) | 45025..45237 | + | 213 | WP_013023861.1 | hypothetical protein | - |
| M5R22_RS24015 (45796) | 45796..46221 | + | 426 | WP_000422741.1 | transposase | - |
| M5R22_RS24020 (46218) | 46218..46568 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M5R22_RS24025 (46599) | 46599..48212 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| M5R22_RS24030 (48290) | 48290..48576 | + | 287 | Protein_55 | DUF2726 domain-containing protein | - |
| - (48543) | 48543..48603 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (48543) | 48543..48603 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (48543) | 48543..48603 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (48543) | 48543..48603 | - | 61 | NuclAT_0 | - | Antitoxin |
| M5R22_RS24035 (48648) | 48648..48782 | + | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| M5R22_RS24040 (49079) | 49079..49333 | + | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| M5R22_RS24045 (49439) | 49439..49570 | + | 132 | Protein_58 | protein CopA/IncA | - |
| M5R22_RS24050 (49570) | 49570..49644 | + | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| M5R22_RS24055 (49637) | 49637..50494 | + | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| M5R22_RS24060 (51434) | 51434..52087 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| M5R22_RS24065 (52180) | 52180..52437 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| M5R22_RS24070 (52370) | 52370..52771 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| M5R22_RS24075 (53020) | 53020..53435 | + | 416 | Protein_64 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB | 1..136642 | 136642 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T256466 WP_023144756.1 NZ_CP103743:48648-48782 [Escherichia coli O25b:H4-ST131]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT256466 NZ_CP103743:c48603-48543 [Escherichia coli O25b:H4-ST131]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
