Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3518421..3519100 | Replicon | chromosome |
Accession | NZ_CP103742 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 2822 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | M5R22_RS17290 | Protein ID | WP_000057523.1 |
Coordinates | 3518798..3519100 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | M5R22_RS17285 | Protein ID | WP_000806442.1 |
Coordinates | 3518421..3518762 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R22_RS17275 (3514665) | 3514665..3515597 | - | 933 | WP_000883041.1 | glutaminase A | - |
M5R22_RS17280 (3515859) | 3515859..3518363 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
M5R22_RS17285 (3518421) | 3518421..3518762 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
M5R22_RS17290 (3518798) | 3518798..3519100 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5R22_RS17295 (3519233) | 3519233..3520027 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
M5R22_RS17300 (3520231) | 3520231..3520710 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
M5R22_RS17305 (3520734) | 3520734..3521534 | + | 801 | WP_000439798.1 | hypothetical protein | - |
M5R22_RS17310 (3521531) | 3521531..3522034 | + | 504 | WP_000667000.1 | hypothetical protein | - |
M5R22_RS17315 (3522072) | 3522072..3523724 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T256459 WP_000057523.1 NZ_CP103742:c3519100-3518798 [Escherichia coli O25b:H4-ST131]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT256459 WP_000806442.1 NZ_CP103742:c3518762-3518421 [Escherichia coli O25b:H4-ST131]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|