Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
| Location | 1864426..1864928 | Replicon | chromosome |
| Accession | NZ_CP103742 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 2822 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | S1P977 |
| Locus tag | M5R22_RS08775 | Protein ID | WP_000767822.1 |
| Coordinates | 1864674..1864928 (+) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | S1Q063 |
| Locus tag | M5R22_RS08770 | Protein ID | WP_001259255.1 |
| Coordinates | 1864426..1864677 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R22_RS08745 (1859604) | 1859604..1860671 | - | 1068 | WP_000080105.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
| M5R22_RS08750 (1860671) | 1860671..1861741 | - | 1071 | WP_000108941.1 | histidinol-phosphate transaminase | - |
| M5R22_RS08755 (1861738) | 1861738..1863042 | - | 1305 | WP_001546022.1 | histidinol dehydrogenase | - |
| M5R22_RS08760 (1863048) | 1863048..1863947 | - | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
| M5R22_RS08765 (1864093) | 1864093..1864143 | - | 51 | WP_001364200.1 | his operon leader peptide | - |
| M5R22_RS08770 (1864426) | 1864426..1864677 | + | 252 | WP_001259255.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
| M5R22_RS08775 (1864674) | 1864674..1864928 | + | 255 | WP_000767822.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
| M5R22_RS08780 (1865011) | 1865011..1865835 | + | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
| M5R22_RS08785 (1865881) | 1865881..1866810 | + | 930 | WP_000803366.1 | LysR substrate-binding domain-containing protein | - |
| M5R22_RS08790 (1867025) | 1867025..1867087 | + | 63 | WP_010723108.1 | membrane protein YoeI | - |
| M5R22_RS08795 (1867077) | 1867077..1868435 | + | 1359 | WP_000019194.1 | putrescine/proton symporter PlaP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10183.58 Da Isoelectric Point: 8.0353
>T256451 WP_000767822.1 NZ_CP103742:1864674-1864928 [Escherichia coli O25b:H4-ST131]
VKLIWSEESWDDYLYWQETDKRIVKKINEIIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQETDKRIVKKINEIIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1P977 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2A6Q | |
| AlphaFold DB | A0A7U9LNR0 |