Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4215377..4216070 | Replicon | chromosome |
Accession | NZ_CP103739 | ||
Organism | Escherichia coli strain 3359 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | U9ZN09 |
Locus tag | M5T33_RS20765 | Protein ID | WP_000415585.1 |
Coordinates | 4215774..4216070 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | M5T33_RS20760 | Protein ID | WP_000650107.1 |
Coordinates | 4215377..4215772 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T33_RS20750 (4211241) | 4211241..4213499 | - | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
M5T33_RS20755 (4213637) | 4213637..4215244 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
M5T33_RS20760 (4215377) | 4215377..4215772 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
M5T33_RS20765 (4215774) | 4215774..4216070 | - | 297 | WP_000415585.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
M5T33_RS20770 (4216275) | 4216275..4216757 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
M5T33_RS20775 (4216810) | 4216810..4217202 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
M5T33_RS20780 (4217354) | 4217354..4218013 | + | 660 | WP_001221502.1 | quorum sensing response regulator transcription factor QseB | - |
M5T33_RS20785 (4218010) | 4218010..4219359 | + | 1350 | WP_000673358.1 | quorum sensing histidine kinase QseC | - |
M5T33_RS20790 (4219405) | 4219405..4219737 | - | 333 | WP_000914690.1 | DUF2645 family protein | - |
M5T33_RS20795 (4219744) | 4219744..4220454 | - | 711 | WP_000834030.1 | hypothetical protein | - |
M5T33_RS20800 (4220457) | 4220457..4220936 | - | 480 | WP_000065332.1 | Hcp family type VI secretion system effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11261.99 Da Isoelectric Point: 8.9070
>T256439 WP_000415585.1 NZ_CP103739:c4216070-4215774 [Escherichia coli]
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT256439 WP_000650107.1 NZ_CP103739:c4215772-4215377 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|