Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2302882..2303253 | Replicon | chromosome |
| Accession | NZ_CP103739 | ||
| Organism | Escherichia coli strain 3359 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A7W3G0W6 |
| Locus tag | M5T33_RS11395 | Protein ID | WP_072130784.1 |
| Coordinates | 2303059..2303253 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2302882..2303060 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T33_RS11370 (2298837) | 2298837..2300210 | + | 1374 | WP_000123737.1 | ATP-dependent RNA helicase DbpA | - |
| M5T33_RS11375 (2300339) | 2300339..2301274 | - | 936 | WP_001157376.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| M5T33_RS11380 (2301326) | 2301326..2302561 | - | 1236 | WP_000040843.1 | site-specific integrase | - |
| M5T33_RS11385 (2302563) | 2302563..2302778 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2302882) | 2302882..2303060 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2302882) | 2302882..2303060 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2302882) | 2302882..2303060 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2302882) | 2302882..2303060 | + | 179 | NuclAT_0 | - | Antitoxin |
| M5T33_RS11390 (2302878) | 2302878..2303066 | - | 189 | WP_001302840.1 | DUF1187 family protein | - |
| M5T33_RS11395 (2303059) | 2303059..2303253 | - | 195 | WP_072130784.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| M5T33_RS11400 (2303310) | 2303310..2304143 | - | 834 | WP_000166322.1 | recombination protein RecT | - |
| M5T33_RS11405 (2304136) | 2304136..2306736 | - | 2601 | WP_000105131.1 | exodeoxyribonuclease VIII | - |
| M5T33_RS11410 (2306838) | 2306838..2307113 | - | 276 | WP_000632297.1 | protein RacC | - |
| M5T33_RS11415 (2307188) | 2307188..2307358 | - | 171 | WP_002431205.1 | YdaE family protein | - |
| M5T33_RS11420 (2307358) | 2307358..2307579 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2301326..2354978 | 53652 | |
| - | inside | Prophage | - | - | 2271345..2381124 | 109779 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7135.00 Da Isoelectric Point: 8.0115
>T256426 WP_072130784.1 NZ_CP103739:c2303253-2303059 [Escherichia coli]
MRYDDVKPCPFCGCPSVTVKDISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTENINGGVHV
MRYDDVKPCPFCGCPSVTVKDISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTENINGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT256426 NZ_CP103739:2302882-2303060 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATTGTAGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATTGTAGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
