Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 741354..742129 | Replicon | chromosome |
Accession | NZ_CP103729 | ||
Organism | Klebsiella pneumoniae strain 197 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1W1JAQ8 |
Locus tag | M5R33_RS03750 | Protein ID | WP_009308645.1 |
Coordinates | 741644..742129 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | M5R33_RS03745 | Protein ID | WP_004150912.1 |
Coordinates | 741354..741647 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R33_RS03725 (736562) | 736562..737164 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
M5R33_RS03730 (737262) | 737262..738173 | + | 912 | WP_004181308.1 | LysR family transcriptional regulator | - |
M5R33_RS03735 (738174) | 738174..739322 | - | 1149 | WP_023301497.1 | PLP-dependent aspartate aminotransferase family protein | - |
M5R33_RS03740 (739333) | 739333..740709 | - | 1377 | WP_004181304.1 | cystathionine beta-synthase | - |
M5R33_RS03745 (741354) | 741354..741647 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
M5R33_RS03750 (741644) | 741644..742129 | + | 486 | WP_009308645.1 | GNAT family N-acetyltransferase | Toxin |
M5R33_RS03755 (742833) | 742833..743426 | + | 594 | WP_114265904.1 | hypothetical protein | - |
M5R33_RS03760 (743523) | 743523..743739 | + | 217 | Protein_737 | transposase | - |
M5R33_RS03770 (744580) | 744580..745293 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 743523..743675 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17595.60 Da Isoelectric Point: 8.5144
>T256389 WP_009308645.1 NZ_CP103729:741644-742129 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1W1JAQ8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |