Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 353663..354309 | Replicon | chromosome |
| Accession | NZ_CP103729 | ||
| Organism | Klebsiella pneumoniae strain 197 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | M5R33_RS01650 | Protein ID | WP_049117416.1 |
| Coordinates | 353663..353989 (+) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | W8UB68 |
| Locus tag | M5R33_RS01655 | Protein ID | WP_002920557.1 |
| Coordinates | 354010..354309 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R33_RS01640 (349589) | 349589..351022 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| M5R33_RS01645 (351040) | 351040..353487 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| M5R33_RS01650 (353663) | 353663..353989 | + | 327 | WP_049117416.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5R33_RS01655 (354010) | 354010..354309 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M5R33_RS01660 (354372) | 354372..355880 | - | 1509 | WP_064149756.1 | glycerol-3-phosphate dehydrogenase | - |
| M5R33_RS01665 (356085) | 356085..356414 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| M5R33_RS01670 (356465) | 356465..357295 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| M5R33_RS01675 (357345) | 357345..358103 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12643.57 Da Isoelectric Point: 5.1769
>T256388 WP_049117416.1 NZ_CP103729:353663-353989 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITMADREFS
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITMADREFS
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|