Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 328930..329516 Replicon chromosome
Accession NZ_CP103727
Organism Klebsiella pneumoniae strain 2289

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M5T50_RS01535 Protein ID WP_002920800.1
Coordinates 329148..329516 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M5T50_RS01530 Protein ID WP_004174006.1
Coordinates 328930..329151 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T50_RS01510 (325087) 325087..326013 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M5T50_RS01515 (326010) 326010..327287 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M5T50_RS01520 (327284) 327284..328051 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M5T50_RS01525 (328053) 328053..328766 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M5T50_RS01530 (328930) 328930..329151 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5T50_RS01535 (329148) 329148..329516 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5T50_RS01540 (329789) 329789..331105 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M5T50_RS01545 (331212) 331212..332099 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M5T50_RS01550 (332096) 332096..332941 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M5T50_RS01555 (332943) 332943..334013 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 326010..334750 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T256373 WP_002920800.1 NZ_CP103727:329148-329516 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT256373 WP_004174006.1 NZ_CP103727:328930-329151 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References