Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3029301..3029961 | Replicon | chromosome |
Accession | NZ_CP103722 | ||
Organism | Enterobacter hormaechei strain 3131 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2J0Q4X0 |
Locus tag | M5R19_RS14675 | Protein ID | WP_017383312.1 |
Coordinates | 3029608..3029961 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A2J0Q4Z7 |
Locus tag | M5R19_RS14670 | Protein ID | WP_017383313.1 |
Coordinates | 3029301..3029603 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R19_RS14655 (M5R19_14655) | 3025475..3026800 | + | 1326 | WP_023303945.1 | SidA/IucD/PvdA family monooxygenase | - |
M5R19_RS14660 (M5R19_14660) | 3026827..3029016 | + | 2190 | WP_045331675.1 | TonB-dependent siderophore receptor | - |
M5R19_RS14670 (M5R19_14670) | 3029301..3029603 | - | 303 | WP_017383313.1 | XRE family transcriptional regulator | Antitoxin |
M5R19_RS14675 (M5R19_14675) | 3029608..3029961 | - | 354 | WP_017383312.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5R19_RS14680 (M5R19_14680) | 3030152..3031102 | - | 951 | WP_017383311.1 | HTH-type transcriptional regulator Cbl | - |
M5R19_RS14685 (M5R19_14685) | 3031199..3032116 | - | 918 | WP_003859531.1 | nitrogen assimilation transcriptional regulator NAC | - |
M5R19_RS14695 (M5R19_14695) | 3032648..3033580 | - | 933 | WP_045340092.1 | L,D-transpeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13537.37 Da Isoelectric Point: 9.9538
>T256369 WP_017383312.1 NZ_CP103722:c3029961-3029608 [Enterobacter hormaechei]
VWAIKTTDRFDDWFTSLNDSERASVLAALLVLRERGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREYTRWLNTLKERN
VWAIKTTDRFDDWFTSLNDSERASVLAALLVLRERGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREYTRWLNTLKERN
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J0Q4X0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J0Q4Z7 |