Detailed information of TA system TA256359

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 50233..50502
• Replicon: plasmid pMB3176_2
• Accession: NZ_CP103720
• Organism: Escherichia coli strain 1579

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5S87_RS26525
• Protein ID: WP_001372321.1
• Coordinates: 50377..50502 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	50233..50298 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5S87_RS26480	45275..45532	+	258	WP_023147917.1	hypothetical protein	-
M5S87_RS26485	45773..45979	+	207	WP_000547968.1	hypothetical protein	-
M5S87_RS26490	46005..46526	+	522	WP_021553184.1	single-stranded DNA-binding protein	-
M5S87_RS26495	46584..46817	+	234	WP_021553185.1	DUF905 domain-containing protein	-
M5S87_RS26500	46881..48845	+	1965	WP_259411958.1	ParB/RepB/Spo0J family partition protein	-
M5S87_RS26505	48914..49348	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
M5S87_RS26510	49345..50107	+	763	Protein_62	plasmid SOS inhibition protein A	-
M5S87_RS26515	50076..50264	-	189	WP_032145107.1	hypothetical protein	-
-	50076..50300	+	225	NuclAT_0	-	-
-	50076..50300	+	225	NuclAT_0	-	-
-	50076..50300	+	225	NuclAT_0	-	-
-	50076..50300	+	225	NuclAT_0	-	-
-	50233..50298	-	66	-	-	Antitoxin
M5S87_RS26520	50286..50435	+	150	Protein_64	plasmid maintenance protein Mok	-
M5S87_RS26525	50377..50502	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5S87_RS26530	50737..51096	-	360	WP_024223173.1	hypothetical protein	-
M5S87_RS26535	51166..51438	+	273	WP_223724002.1	single-stranded DNA-binding protein	-
M5S87_RS26540	51392..51715	+	324	WP_000533253.1	hypothetical protein	-
M5S87_RS26545	51774..52016	+	243	WP_000540591.1	hypothetical protein	-
M5S87_RS26550	52216..52639	-	424	Protein_70	hypothetical protein	-
M5S87_RS26555	52709..52915	+	207	WP_000547968.1	hypothetical protein	-
M5S87_RS26560	52939..53235	+	297	WP_021553188.1	hypothetical protein	-
M5S87_RS26565	53346..54167	+	822	WP_021553189.1	DUF932 domain-containing protein	-
M5S87_RS26570	54463..54972	-	510	WP_021553190.1	transglycosylase SLT domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..83426	83426

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T256359 WP_001372321.1 NZ_CP103720:50377-50502 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT256359 NZ_CP103720:c50298-50233 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin