Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 11141..11394 Replicon plasmid pMB3176_2
Accession NZ_CP103720
Organism Escherichia coli strain 1579

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag M5S87_RS26245 Protein ID WP_001312851.1
Coordinates 11245..11394 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 11141..11200 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S87_RS26220 (7432) 7432..9021 + 1590 WP_251704617.1 YadA-like family protein -
M5S87_RS26225 (9023) 9023..9484 + 462 WP_021553165.1 thermonuclease family protein -
M5S87_RS26230 (9530) 9530..9739 + 210 WP_001333231.1 hemolysin expression modulator Hha -
M5S87_RS26235 (9777) 9777..10370 + 594 WP_100033381.1 DUF2726 domain-containing protein -
M5S87_RS26240 (10525) 10525..10998 + 474 WP_100033380.1 hypothetical protein -
- (11141) 11141..11200 - 60 NuclAT_1 - Antitoxin
- (11141) 11141..11200 - 60 NuclAT_1 - Antitoxin
- (11141) 11141..11200 - 60 NuclAT_1 - Antitoxin
- (11141) 11141..11200 - 60 NuclAT_1 - Antitoxin
M5S87_RS26245 (11245) 11245..11394 + 150 WP_001312851.1 Hok/Gef family protein Toxin
M5S87_RS26250 (11678) 11678..11935 + 258 WP_000083826.1 replication regulatory protein RepA -
M5S87_RS26255 (12170) 12170..12244 + 75 WP_001365705.1 RepA leader peptide Tap -
M5S87_RS26260 (12237) 12237..13094 + 858 WP_126303380.1 incFII family plasmid replication initiator RepA -
M5S87_RS26265 (14088) 14088..15014 + 927 WP_016230921.1 tricarballylate utilization LysR family transcriptional regulator TcuR -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..83426 83426


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T256354 WP_001312851.1 NZ_CP103720:11245-11394 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT256354 NZ_CP103720:c11200-11141 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References