Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 11141..11394 | Replicon | plasmid pMB3176_2 |
| Accession | NZ_CP103720 | ||
| Organism | Escherichia coli strain 1579 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M5S87_RS26245 | Protein ID | WP_001312851.1 |
| Coordinates | 11245..11394 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 11141..11200 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S87_RS26220 (7432) | 7432..9021 | + | 1590 | WP_251704617.1 | YadA-like family protein | - |
| M5S87_RS26225 (9023) | 9023..9484 | + | 462 | WP_021553165.1 | thermonuclease family protein | - |
| M5S87_RS26230 (9530) | 9530..9739 | + | 210 | WP_001333231.1 | hemolysin expression modulator Hha | - |
| M5S87_RS26235 (9777) | 9777..10370 | + | 594 | WP_100033381.1 | DUF2726 domain-containing protein | - |
| M5S87_RS26240 (10525) | 10525..10998 | + | 474 | WP_100033380.1 | hypothetical protein | - |
| - (11141) | 11141..11200 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (11141) | 11141..11200 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (11141) | 11141..11200 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (11141) | 11141..11200 | - | 60 | NuclAT_1 | - | Antitoxin |
| M5S87_RS26245 (11245) | 11245..11394 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M5S87_RS26250 (11678) | 11678..11935 | + | 258 | WP_000083826.1 | replication regulatory protein RepA | - |
| M5S87_RS26255 (12170) | 12170..12244 | + | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| M5S87_RS26260 (12237) | 12237..13094 | + | 858 | WP_126303380.1 | incFII family plasmid replication initiator RepA | - |
| M5S87_RS26265 (14088) | 14088..15014 | + | 927 | WP_016230921.1 | tricarballylate utilization LysR family transcriptional regulator TcuR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..83426 | 83426 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T256354 WP_001312851.1 NZ_CP103720:11245-11394 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT256354 NZ_CP103720:c11200-11141 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|