Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 55886..56140 | Replicon | plasmid pMB3176_1 |
| Accession | NZ_CP103719 | ||
| Organism | Escherichia coli strain 1579 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M5S87_RS25095 | Protein ID | WP_001312851.1 |
| Coordinates | 55991..56140 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 55886..55947 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S87_RS25060 (51538) | 51538..51750 | + | 213 | WP_005012601.1 | hypothetical protein | - |
| M5S87_RS25065 (52051) | 52051..52140 | - | 90 | Protein_69 | IS1 family transposase | - |
| M5S87_RS25070 (52195) | 52195..52872 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| M5S87_RS25075 (52872) | 52872..53219 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M5S87_RS25080 (53239) | 53239..54810 | + | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| M5S87_RS25085 (54848) | 54848..55464 | - | 617 | Protein_73 | IS1 family transposase | - |
| M5S87_RS25090 (55565) | 55565..55747 | + | 183 | WP_000968309.1 | hypothetical protein | - |
| - (55886) | 55886..55947 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (55886) | 55886..55947 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (55886) | 55886..55947 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (55886) | 55886..55947 | - | 62 | NuclAT_1 | - | Antitoxin |
| M5S87_RS25095 (55991) | 55991..56140 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M5S87_RS25100 (56424) | 56424..56681 | + | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| M5S87_RS25105 (56917) | 56917..56991 | + | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| M5S87_RS25110 (56984) | 56984..57430 | + | 447 | Protein_78 | plasmid replication initiator RepA | - |
| M5S87_RS25115 (57430) | 57430..58044 | - | 615 | Protein_79 | VENN motif pre-toxin domain-containing protein | - |
| M5S87_RS25120 (58751) | 58751..59971 | + | 1221 | WP_000410951.1 | arginine deiminase | - |
| M5S87_RS25125 (59982) | 59982..60893 | + | 912 | WP_000440183.1 | carbamate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / qacE / aadA5 / dfrA17 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / mph(A) / tet(B) | - | 1..250715 | 250715 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T256350 WP_001312851.1 NZ_CP103719:55991-56140 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT256350 NZ_CP103719:c55947-55886 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|