Detailed information of TA system TA256347

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 15620..16046
• Replicon: plasmid pMB3176_1
• Accession: NZ_CP103719
• Organism: Escherichia coli strain 1579

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5S87_RS24850
• Protein ID: WP_001372321.1
• Coordinates: 15921..16046 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	15620..15844 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5S87_RS24795 (11893)	11893..12458	+	566	Protein_15	class I SAM-dependent methyltransferase	-
M5S87_RS24800 (12484)	12484..12696	+	213	WP_001348622.1	hypothetical protein	-
M5S87_RS24805 (12609)	12609..12866	+	258	WP_023147917.1	hypothetical protein	-
M5S87_RS24810 (13106)	13106..13312	+	207	WP_000275856.1	hypothetical protein	-
M5S87_RS24815 (13338)	13338..13877	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
M5S87_RS24820 (13945)	13945..14178	+	234	WP_000005990.1	DUF905 family protein	-
M5S87_RS24825 (14206)	14206..14403	+	198	Protein_21	hypothetical protein	-
M5S87_RS24830 (14458)	14458..14892	+	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
M5S87_RS24835 (14889)	14889..15651	+	763	Protein_23	plasmid SOS inhibition protein A	-
M5S87_RS24840 (15620)	15620..15808	-	189	WP_001299721.1	hypothetical protein	-
- (15620)	15620..15844	+	225	NuclAT_0	-	Antitoxin
- (15620)	15620..15844	+	225	NuclAT_0	-	Antitoxin
- (15620)	15620..15844	+	225	NuclAT_0	-	Antitoxin
- (15620)	15620..15844	+	225	NuclAT_0	-	Antitoxin
M5S87_RS24845 (15830)	15830..15979	+	150	Protein_25	plasmid maintenance protein Mok	-
M5S87_RS24850 (15921)	15921..16046	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5S87_RS24855 (16266)	16266..16496	+	231	WP_071886920.1	hypothetical protein	-
M5S87_RS24860 (16494)	16494..16666	-	173	Protein_28	hypothetical protein	-
M5S87_RS24865 (16736)	16736..16942	+	207	WP_000547968.1	hypothetical protein	-
M5S87_RS24870 (16967)	16967..17254	+	288	WP_000107535.1	hypothetical protein	-
M5S87_RS24875 (17372)	17372..18193	+	822	WP_001234426.1	DUF932 domain-containing protein	-
M5S87_RS24880 (18490)	18490..19092	-	603	WP_013362798.1	transglycosylase SLT domain-containing protein	-
M5S87_RS24885 (19413)	19413..19796	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M5S87_RS24890 (19983)	19983..20672	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sul1 / qacE / aadA5 / dfrA17 / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / mph(A) / tet(B)	-	1..250715	250715

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T256347 WP_001372321.1 NZ_CP103719:15921-16046 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT256347 NZ_CP103719:15620-15844 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin