Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4925444..4926046 | Replicon | chromosome |
Accession | NZ_CP103718 | ||
Organism | Escherichia coli strain 1579 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | M5S87_RS23730 | Protein ID | WP_000897305.1 |
Coordinates | 4925735..4926046 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5S87_RS23725 | Protein ID | WP_000356395.1 |
Coordinates | 4925444..4925734 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S87_RS23690 (4921067) | 4921067..4921969 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
M5S87_RS23695 (4921966) | 4921966..4922601 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5S87_RS23700 (4922598) | 4922598..4923527 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
M5S87_RS23705 (4923709) | 4923709..4923951 | - | 243 | WP_021523315.1 | hypothetical protein | - |
M5S87_RS23710 (4924170) | 4924170..4924388 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
M5S87_RS23715 (4924807) | 4924807..4925085 | - | 279 | WP_001306650.1 | hypothetical protein | - |
M5S87_RS23720 (4925147) | 4925147..4925359 | - | 213 | WP_000197769.1 | hypothetical protein | - |
M5S87_RS23725 (4925444) | 4925444..4925734 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
M5S87_RS23730 (4925735) | 4925735..4926046 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
M5S87_RS23735 (4926275) | 4926275..4927183 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
M5S87_RS23740 (4927352) | 4927352..4928266 | - | 915 | WP_077634137.1 | transposase | - |
M5S87_RS23745 (4928279) | 4928279..4929166 | - | 888 | Protein_4641 | hypothetical protein | - |
M5S87_RS23750 (4929582) | 4929582..4930523 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
M5S87_RS23755 (4930568) | 4930568..4931005 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T256346 WP_000897305.1 NZ_CP103718:c4926046-4925735 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|